KEGG   Staphylococcus carnosus: SCA_1017Help
Entry
SCA_1017          CDS       T00863                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sca  Staphylococcus carnosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCA_1017 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCA_1017 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCA_1017 (trpB)
Enzymes [BR:sca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCA_1017 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1033338..1034567
Genome map
AA seq 409 aa AA seqDB search
MTKDTKQPIQTEVDELGFFGEYGGRYVPETLMPAIQELRQAYEEAKDDPAFQEELAGYLK
DYVGRATPLTYADSYTKQLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAE
TGAGQHGVASATVAALFDMELVVFMGEEDIQRQALNVFRMELLGAKVVSVTDGQGTLSDA
VNKALQYWVSHVEDTHYLLGSALGPDPFPTMVRDFQSVIGSEIKEQLQEKEGRLPDAVVA
CVGGGSNSIGTFYPFVEDESVKLYGVEAAGDGEDTDKHALAIGKGSVGVLHGTKMYLLQN
EEGQIGLAHSISAGLDYPGIGPEHSYYSDIGRAEYPSASDDEAMEALVRFTKAEGIIPAI
ESAHALSYVEKLAPTMDKDEIIVVTVSGRGDKDMDTIRKYMKERGADNE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagacacaaaacaacccattcaaacagaagtagatgaactaggatttttcgga
gaatacggtggacgttatgttccagaaacattaatgccagctattcaagaattaagacaa
gcatatgaagaagctaaagatgatccagcattccaagaagaattagcaggttacttaaaa
gactatgtaggacgtgctactccgcttacttatgctgattcatatacaaaacaacttggc
ggtgcaaaaatttatttgaaacgtgaagacttgaaccacacaggtgcacacaaaatcaac
aatgcattaggccaagcgttgcttgctaaacgaatgggcaaaaagaaattagttgctgaa
acaggcgcaggacaacatggtgttgcaagtgcaacagtagctgcattatttgatatggag
cttgttgtatttatgggagaagaagatattcaacgccaagcattgaatgttttcagaatg
gaattattaggcgcaaaagtagtttcagtcactgatggtcaaggtacattatcagatgct
gtaaacaaggcactgcaatattgggtcagtcatgttgaagacactcactatttattagga
tcagcactgggaccagatccattcccaactatggtgcgtgatttccaaagtgtcatcggc
agtgaaattaaagaacaattacaagaaaaagaagggcgtttgccggatgcagtggtagca
tgtgtaggcggcggttctaattcaatcggtacattctatccatttgttgaagatgaaagt
gtgaaattatatggcgtggaagcagcaggtgacggtgaagatacagacaagcatgcactt
gcaatcggtaaaggttctgtaggtgtattgcatggtactaaaatgtatcttttacaaaac
gaagaaggacaaattggtcttgcacattctatttctgcaggattagattaccctggtatc
ggacctgaacacagctattatagtgatatcggtcgtgctgaatatccaagtgcttcagat
gatgaagcgatggaagcattagtacgcttcactaaagcagaaggtattattccagctatt
gaaagtgcgcatgcgttaagttatgtagaaaaattagcaccaacaatggataaagatgaa
attattgttgtaacagtttctggacgcggagataaagatatggatactatcagaaaatat
atgaaagaaagaggtgctgataatgagtaa

DBGET integrated database retrieval system