KEGG   Staphylococcus carnosus: SCA_1018Help
Entry
SCA_1018          CDS       T00863                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sca  Staphylococcus carnosus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCA_1018 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCA_1018 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCA_1018 (trpA)
Enzymes [BR:sca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCA_1018 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1034560..1035312
Genome map
AA seq 250 aa AA seqDB search
MSKLFIPYIMGNKDFISNLKVLSDEGADIVEIGLPFSDPVADGPTIMEAGNKAIEEGMNA
RKILQELKAHKDELKDTKYVLMTYYNIILHYGEEQFIKDCEAAGVYGLIIPDLPFELGEQ
LKERFKDSSVKIISLIAMTASDDRIQKIAQHADGFIYTVTMNATTGENGQFHPELQSKIE
YIQKNADVPVVAGFGIRNPEQVSTLSEFTDGIVIGSEIVKRFANDSETSIRQYLQSIRRA
LDETKAAANS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattattcattccttatatcatgggcaataaagattttatttctaatttaaaa
gtactaagtgatgaaggtgcagacattgtagaaattggtttgccattctctgatccagtt
gctgacggaccaacgattatggaagcaggcaataaagcgattgaagaaggtatgaatgca
cgcaaaattttacaagagttgaaagcacataaagatgaattgaaggatacaaaatatgta
ttaatgacatattacaatattatcttgcactatggtgaagaacaattcatcaaagattgt
gaagcagctggcgtgtatggtttaattattcctgatttaccatttgaattaggagagcag
ttgaaagaacgttttaaagacagcagtgtcaaaatcatttcattgattgcaatgaccgct
tctgatgaccgtattcaaaagattgcacaacatgctgatggtttcatttacacagttaca
atgaatgcaacaactggagaaaatggccagttccacccagaactgcaaagtaaaattgag
tacattcaaaaaaatgcagatgttcctgtcgtagctggattcggaatcagaaatccagaa
caagtatcgacactatctgaatttacagatggcatcgtcatcggtagtgaaattgtaaaa
cgttttgccaatgatagcgaaacgtcaatcagacaatacttgcaaagtattcgtcgtgca
ttggatgaaacaaaagcagcagcaaactcataa

DBGET integrated database retrieval system