KEGG   Staphylococcus carnosus: Sca_1169Help
Entry
Sca_1169          CDS       T00863                                 

Gene name
glcA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sca  Staphylococcus carnosus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sca_1169 (glcA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sca_1169 (glcA)
   00052 Galactose metabolism
    Sca_1169 (glcA)
   00500 Starch and sucrose metabolism
    Sca_1169 (glcA)
   00520 Amino sugar and nucleotide sugar metabolism
    Sca_1169 (glcA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sca_1169 (glcA)
   00524 Butirosin and neomycin biosynthesis
    Sca_1169 (glcA)
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sca_1169 (glcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1183071..1184057)
Genome map
AA seq 328 aa AA seqDB search
MKNLILAADVGGTTCKLGIFDNHLDRLAKWSIQTDVSDPTGVVLLKTIYSAFVQKLNELN
LKMEDVIGLGVGVPGPVDFETGIVHGAVNLNWPGDVNIREILSQFVNFPIYVDNDANAAA
LGEKHKGAGHNADDVVAITLGTGVGGGIISNGKLVHGHNGSGAEIGHFRVDFDQRFACNC
GKYGCLETVASATGVVNLVKFYHPKLTIKSSILELIKEDRVTAKDVFDASKKGDLFCLFI
TERVANYIAYACSIISVMSNPKYIILGGGMSEAGDILIENIKTEYRNLTFTPAQNGTEIV
KAQLGNDAGIAGAAGLIKTYVIDEERVE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaatattggcagctgatgttggcgggacaacatgtaaattaggaatattt
gataatcatctagatagactagcaaagtggtcaatacaaacagatgtcagtgatccgaca
ggcgttgtattactcaaaacaatttatagtgcttttgttcaaaaattaaatgaacttaac
cttaaaatggaagatgtgattgggctaggcgtaggtgtaccaggccctgttgattttgag
actggtatagttcacggagcagtaaatttaaattggccgggagacgttaatattagagag
attttatcacaatttgttaattttccgatttacgttgataatgatgctaacgcagcagca
ttaggtgaaaaacataaaggcgctggccacaatgctgatgatgttgttgctattacactt
ggtacaggtgtaggtggtggtataatttcaaatgggaaattagtgcatggacataacggt
tctggtgcagaaattggacatttccgtgtagattttgatcaaagatttgcttgtaattgt
ggaaaatacggttgtttagaaactgttgcatctgcaacaggtgttgttaatttagtgaaa
ttttatcatcctaaactaactattaaatcttcaattttagaacttattaaagaagatcgt
gttacagctaaagatgtgtttgatgcttcgaaaaagggagacttattctgtttatttata
actgaaagagttgctaactatattgcgtatgcttgtagcatcatcagtgttatgagtaac
ccaaaatatattattttaggtggcggtatgtctgaagcaggagacatcttaattgaaaat
attaaaacagaataccgtaaccttacattcaccccagctcaaaatggaacagaaattgtt
aaagcccaacttggtaatgatgctggaattgcaggggcagctggtttaattaaaacatat
gtaattgacgaggagcgtgttgaataa

DBGET integrated database retrieval system