KEGG   Staphylococcus carnosus: Sca_1274Help
Entry
Sca_1274          CDS       T00863                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sca  Staphylococcus carnosus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sca_1274 (hemB)
Enzymes [BR:sca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sca_1274 (hemB)
Exosome [BR:sca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sca_1274 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1282152..1283135)
Genome map
AA seq 327 aa AA seqDB search
MSFDRHRRLRANKTIRSLVRENHVRKEDLIYPIFVVERDDVKEEIPSMPGIYQISLNRLD
EELKEAYDLGIRAVIFFGVPNEKDSVGTGAYAHEGIVQQATRKSKKLYPDMLVIADTCLC
EYTDHGHCGLIDEHTHDVDNDKSLPLLVKTAVSQVEAGADIIAPSNMMDGFVTEIRKGLD
EAGYYNIPIMSYGIKYASSFYGPFRDAAESTPSFGDRKTYQMDPSNRREALLELESDLHE
GADMMIVKPSLSFLDIIRDVRERTNVPVIAYNVSGEYSMTKAAALQGWIDEEQIVMEQMT
SMKRAGADMIITYFSKDICRYLDKKED
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgatagacatagaagactacgtgcaaataaaacaattcgtagccttgtcaga
gaaaatcacgttagaaaagaagatttgatttatccaatatttgttgtggaaagagatgac
gttaaagaagaaattccttccatgccaggtatttatcaaatcagcttgaatcgtttggat
gaagaattaaaagaagcttatgatttaggtatcagagccgttattttcttcggagttcca
aatgaaaaggattccgtaggtactggcgcttatgcgcatgaaggtattgttcaacaagca
acacgtaaatctaaaaaattatatccagatatgttagtcattgctgatacttgcttatgt
gaatatacagatcatggtcattgcggtttaattgatgaacatactcatgatgttgataat
gacaaatcattaccgcttcttgtaaaaacagcagtttctcaagttgaagcgggtgcagat
attatcgcaccaagtaatatgatggacggtttcgtcacagaaatcagaaaaggtttagat
gaagcaggatattacaatattccaattatgagttatggtattaaatacgcttcaagcttc
tatggtccattccgtgatgctgcagaatcaacaccttcatttggggaccgtaaaacttat
caaatggatccatcaaatcgccgtgaagctttattagaattagaaagtgatttgcatgaa
ggtgcagatatgatgattgtaaaaccatcattaagtttcttagatatcattagagatgta
agagagagaacgaatgtaccagtcattgcttataatgtaagtggtgaatacagcatgact
aaagctgctgcattacaaggttggattgatgaagaacaaatcgtaatggaacaaatgaca
tctatgaaacgtgcaggcgcagatatgattattacttatttctctaaagatatctgccgt
tatttagataagaaggaggattaa

DBGET integrated database retrieval system