KEGG   Staphylococcus carnosus: SCA_1275Help
Entry
SCA_1275          CDS       T00863                                 

Gene name
hemD
Definition
(GenBank) putative uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sca  Staphylococcus carnosus
Pathway
sca00860  Porphyrin and chlorophyll metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCA_1275 (hemD)
Enzymes [BR:sca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SCA_1275 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ANF_receptor
Motif
Other DBs
NCBI-ProteinID: CAL28181
UniProt: B9DNE0
Position
complement(1283132..1283821)
Genome map
AA seq 229 aa AA seqDB search
MQTPVIMTQSSNIKSEDEDIIHLPFIKIKPLSFNEALLNHHYDWIIFSSKNAVKYFRDYF
QQLNVDYVAAIGEKTKDYCNQVGISVDFFPKNFSQEGFIDEFKVNQGDRIIIPSSAAARP
FLQKELQEKNAEVVKIDLYEPEAYTENILQAISLLKRNLANGIAFASSSAADNFFKEAEN
LNLDSNYNYYAIGRPTFEKIEEYGYTAKIAEEQTIDGLLKIIKESRNRK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaccagtgattatgacacaatccagcaatataaaaagtgaagatgaggatatt
attcatcttccttttattaagattaaaccattgtcttttaacgaagcgcttttaaatcat
cattatgactggattatattttcatcaaaaaatgcggtgaaatatttccgtgattatttt
caacaattaaacgttgattacgttgctgctattggtgaaaaaacgaaagattactgtaat
caagttggaatttctgttgatttctttcctaaaaatttttcgcaagaaggatttatagat
gagttcaaagtgaatcaaggggataggataattattccgagcagtgcagctgcacgtcca
tttttacaaaaagaacttcaagaaaaaaatgcagaagtcgtcaaaatagatttatatgaa
ccagaggcatacactgaaaatatattacaagcaatttctttattaaaaagaaatcttgcg
aatggcatagcatttgcaagttcttctgctgcagataattttttcaaagaagctgaaaac
ttaaatcttgattcaaattataattattatgctattggtagacctacttttgaaaagata
gaagaatatggttataccgcaaaaatagctgaagagcaaacgattgatggattattaaaa
ataattaaagaaagtaggaatcgtaaatga

DBGET integrated database retrieval system