KEGG   Staphylococcus carnosus: SCA_1304Help
Entry
SCA_1304          CDS       T00863                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00030  Pentose phosphate pathway
sca00051  Fructose and mannose metabolism
sca00052  Galactose metabolism
sca00680  Methane metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
sca01230  Biosynthesis of amino acids
sca03018  RNA degradation
Module
sca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sca_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_1304 (pfk)
   00030 Pentose phosphate pathway
    SCA_1304 (pfk)
   00051 Fructose and mannose metabolism
    SCA_1304 (pfk)
   00052 Galactose metabolism
    SCA_1304 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SCA_1304 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCA_1304 (pfk)
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCA_1304 (pfk)
Protein phosphatases and associated proteins [BR:sca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCA_1304 (pfk)
Messenger RNA biogenesis [BR:sca03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SCA_1304 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAL28209
UniProt: B9DN94
Position
complement(1315676..1316644)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTAIYNGIEVYGVYQGYLGLINDDLKKLELGSVGDT
IQRGGTFLYSARCPEFKDKEVRAKAIENLRSRGIDGLVVIGGDGSYRGAQRISEECPEIQ
TIGIPGTIDNDIPGTDYTIGFDSALNTIIESVDKIRDTASSHARTFIVEVMGRDCGDLAL
WAGLAVGAETIIVPEEKVDIKDVAEKIESGIKRGKKHSIVVVAEGVMGGQLCADELAKYI
HVDARVSVLGHIQRGGSPTGQDRVLASRLGGHAVELLMDGKTALGVGIKQNQLTQTKFED
IFNNKGSKFDKQMYKLAQELSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagttttaacaagtggcggagacgcaccgggaatgaatgctgctatt
cgagcagttgtgcgtacagctatttataatgggattgaagtttatggtgtgtatcaaggc
tatctaggattaatcaatgatgatcttaagaaacttgaattaggatcagtgggagatacg
attcaaagaggcggtacattcttatattctgcacgttgtccagaattcaaggacaaagaa
gttcgtgcaaaagcaattgagaatttgcgttctagaggaattgatggactcgttgtaata
ggtggagacggtagttatcgcggtgcacaacgcatcagtgaagaatgtccagaaatacaa
actatcggtatccctggtacaattgacaatgacattccaggaactgattacacaatcggt
tttgattcagcattaaatacaattattgaatctgtggataaaatcagagatacagcttca
agccatgcacgtacttttattgttgaagtaatgggccgagattgtggtgatcttgcattg
tgggctggtttagctgtcggagcagagacaattattgttcctgaagaaaaagtagatatt
aaagatgttgctgaaaaaattgaatctggtattaaacgtggcaaaaaacactctattgtc
gtggtggcagaaggtgttatgggcggccaactatgtgctgatgaattagcaaaatacatt
cacgtcgatgcccgtgtatcagttttaggtcatatccaacgtggaggaagcccaacaggt
caagatagagtactggcatcaagattaggtggacatgcagttgaattattgatggatgga
aaaacggcgttaggtgtaggtatcaaacaaaatcaacttacacaaacaaagtttgaggac
attttcaataacaagggaagtaaatttgataaacagatgtataaacttgcacaagaatta
tcaatttaa

DBGET integrated database retrieval system