KEGG   Staphylococcus carnosus: Sca_1304Help
Entry
Sca_1304          CDS       T00863                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sca  Staphylococcus carnosus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sca_1304 (pfk)
   01230 Biosynthesis of amino acids
    Sca_1304 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sca_1304 (pfk)
   00030 Pentose phosphate pathway
    Sca_1304 (pfk)
   00051 Fructose and mannose metabolism
    Sca_1304 (pfk)
   00052 Galactose metabolism
    Sca_1304 (pfk)
  Energy metabolism
   00680 Methane metabolism
    Sca_1304 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sca_1304 (pfk)
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sca_1304 (pfk)
Protein phosphatases and associated proteins [BR:sca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sca_1304 (pfk)
Messenger RNA biogenesis [BR:sca03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sca_1304 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1315676..1316644)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTAIYNGIEVYGVYQGYLGLINDDLKKLELGSVGDT
IQRGGTFLYSARCPEFKDKEVRAKAIENLRSRGIDGLVVIGGDGSYRGAQRISEECPEIQ
TIGIPGTIDNDIPGTDYTIGFDSALNTIIESVDKIRDTASSHARTFIVEVMGRDCGDLAL
WAGLAVGAETIIVPEEKVDIKDVAEKIESGIKRGKKHSIVVVAEGVMGGQLCADELAKYI
HVDARVSVLGHIQRGGSPTGQDRVLASRLGGHAVELLMDGKTALGVGIKQNQLTQTKFED
IFNNKGSKFDKQMYKLAQELSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagttttaacaagtggcggagacgcaccgggaatgaatgctgctatt
cgagcagttgtgcgtacagctatttataatgggattgaagtttatggtgtgtatcaaggc
tatctaggattaatcaatgatgatcttaagaaacttgaattaggatcagtgggagatacg
attcaaagaggcggtacattcttatattctgcacgttgtccagaattcaaggacaaagaa
gttcgtgcaaaagcaattgagaatttgcgttctagaggaattgatggactcgttgtaata
ggtggagacggtagttatcgcggtgcacaacgcatcagtgaagaatgtccagaaatacaa
actatcggtatccctggtacaattgacaatgacattccaggaactgattacacaatcggt
tttgattcagcattaaatacaattattgaatctgtggataaaatcagagatacagcttca
agccatgcacgtacttttattgttgaagtaatgggccgagattgtggtgatcttgcattg
tgggctggtttagctgtcggagcagagacaattattgttcctgaagaaaaagtagatatt
aaagatgttgctgaaaaaattgaatctggtattaaacgtggcaaaaaacactctattgtc
gtggtggcagaaggtgttatgggcggccaactatgtgctgatgaattagcaaaatacatt
cacgtcgatgcccgtgtatcagttttaggtcatatccaacgtggaggaagcccaacaggt
caagatagagtactggcatcaagattaggtggacatgcagttgaattattgatggatgga
aaaacggcgttaggtgtaggtatcaaacaaaatcaacttacacaaacaaagtttgaggac
attttcaataacaagggaagtaaatttgataaacagatgtataaacttgcacaagaatta
tcaatttaa

DBGET integrated database retrieval system