KEGG   Staphylococcus carnosus: Sca_1358Help
Entry
Sca_1358          CDS       T00863                                 

Gene name
pepV
Definition
dipeptidase PepV (EC:3.4.13.3)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sca  Staphylococcus carnosus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sca01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sca00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1374854..1376263)
Genome map
AA seq 469 aa AA seqDB search
MWKEKVQEYEDQIIADLSGLLSIESVRDDSKATSDAPLGPGPKAALDYMYQLAERDGFAT
HDVDHVAGRIEVGKGEDLFGILCHVDVVPAGEGWDTPPFEPTVTDDAIIARGTLDDKGPT
IAAYYAVKILNDMNVDWKKRVHIIVGTDEESDWIGVNRYFESEEMPALGFAPDAEFPAIH
GEKGITTFDIKQENKTADEQGADVVLESFESGQRYNMVPDEAVARLTVKADDLDITELYQ
NYLDAHDLNGTSELDGDTLVLRLKGKAVHGMDPSIGLNAGLFLIHFLNELNLDSQAAKFT
DLSERYLFESHFGEKMGMKFHTDKMGDLTTNIGIISYSKDKGGEYGINLRYPEGFEFDDA
IKRFANEVNELGFELDLGKVQRPHYVDKNDPFVQTLVQAYRNQTGDMTEPYTIGGGTYAR
NLDKGVAFGAMFSDSEDLMHQRNEYITKKQLFNATSIYLEALYALCVEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaagtgcaagaatatgaagatcaaattatagctgatttatccggatta
ctatctatagaaagtgttagagatgatagtaaagcaacatctgatgcaccgctcggacca
ggaccaaaagctgcgcttgattatatgtatcaactcgcagaacgtgatggatttgctaca
catgatgtagatcatgtggcaggaagaatcgaagtcggtaaaggtgaagatttattcggc
attctttgtcacgtcgatgttgtccctgctggagaaggatgggatacaccaccttttgaa
cctacagttacagatgacgcgattatcgctagaggcactttagatgataaaggacctaca
atcgcagcatattatgcagttaaaattttgaatgatatgaatgttgattggaaaaaacgt
gtacacattattgtaggtacagatgaagagtcagattggattggcgtaaaccgttatttt
gaatctgaagaaatgcctgctttaggttttgcgcctgatgctgaattccctgcaattcat
ggtgaaaaaggtatcactacatttgatattaaacaagaaaataaaacagctgatgaacaa
ggtgcagatgtcgtattggaatcatttgaatcaggacaacgttataatatggtacctgat
gaagcggttgcacgtctgactgtgaaagcagatgatcttgatattacagaactgtaccaa
aattatttagatgcgcatgacttaaatggtacaagtgagttagatggagatactttagtt
ttacgcttaaaaggtaaagcagttcatggtatggatccttcaataggattaaatgctggt
ttattcttgattcatttcttaaatgaattgaatctagatagtcaagcagcaaaatttacg
gacttaagtgaaagatatttatttgaatcacactttggagaaaaaatgggtatgaaattc
catactgataaaatgggagatttaacaacaaatatcggtattatttcatattcaaaagat
aaaggcggagaatacggcattaatttacgttatccggaaggatttgaatttgatgacgca
attaaacgttttgcaaatgaagtaaatgaattgggatttgaattagatttaggtaaggta
caacgccctcattatgttgataaaaacgatccgtttgtacaaacacttgtacaagcatat
cgtaaccaaacaggggatatgacagaaccgtatacaattggcggcggcacatatgcacgt
aacctagataaaggcgtagcattcggagcgatgttcagcgactcagaggacttaatgcat
caaagaaatgaatacatcactaaaaaacaattatttaatgcaactagcatttatttagaa
gcgctatatgcattatgtgtggaggaatga

DBGET integrated database retrieval system