KEGG   Staphylococcus carnosus: SCA_1406Help
Entry
SCA_1406          CDS       T00863                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sca  Staphylococcus carnosus
Pathway
sca00860  Porphyrin and chlorophyll metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCA_1406 (hemY)
Enzymes [BR:sca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SCA_1406 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SCA_1406 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 Pyr_redox MCRA HI0933_like NAD_binding_9 Pyr_redox_3 FAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: CAL28311
UniProt: B9DMZ8
Position
complement(1423045..1424445)
Genome map
AA seq 466 aa AA seqDB search
MTKKIAIIGAGITGLSAAYYLKKEYPQFDAHVIEATNRAGGKIQTYRKDGYTIELGPESY
LGRKKIMTELAEEIGLGDDLITNQTGQSYIYANNHLYPIPGGSIMGIPTDVKPFISTKLI
SVKGKIRAAMDLFKKPVAMQDGDISVGHFFRERLGDEVLENLIEPLMGGIYGTNIDDLSL
MSTFPNFKEREEQYNSLIKGMRHEKQLRQSQKKLYPGAPKGQFKQFRHGLSSFIEALEQA
VKNQGTEILYNTKVEDIISSQRGYDVVYNGEKHFYDGVLVTVPHQTFMQWFSEDPALDYF
KTMDSTSVATVVLAFDEKDVENTYDGTGFVIARTSDTRITACTWTSKKWPFTTPEGKVLL
RAYVGKPGDHILEEMNDEQIVSTVRKDLSQMMTIKGNPEFSIVNRLPKSMPQYHVGHIQR
IRDIQAHIRQTYPHLRITGAGFEAVGLPDCIQQGKDAVEELAATVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattgcaattatcggagcaggcattacaggtttatcagcggcatattat
ttaaaaaaagaatatccgcaatttgatgctcatgttattgaagcaacaaaccgtgctggc
ggtaaaattcaaacgtatcgcaaagatggctatacaatcgaattgggtccggaatcttat
ttgggcagaaaaaaaatcatgactgaattagcggaagaaatcggtttaggtgatgattta
attacgaatcaaactggtcaatcatatatatatgcgaacaatcatttatatcctattcca
ggcggttcaattatgggtatacctacagatgttaaaccttttatcagtacaaaactgatt
tctgttaaaggtaagattcgtgcagcaatggatttatttaaaaaaccagtagctatgcaa
gatggtgatatttctgtaggacactttttcagagaacgtcttggcgatgaagtgctggaa
aatttaattgaacctttaatgggtggaatttatggtaccaatattgatgatttgagttta
atgagtacttttcctaatttcaaagaacgtgaagaacaatacaatagtttaattaaaggt
atgcgtcatgagaagcaattacgacaaagtcagaaaaaactctatcctggtgcgcctaaa
ggtcagtttaaacaattcagacatggtttaagttcatttattgaagcgctcgaacaagct
gtaaaaaatcaaggtactgaaatcttatataacactaaagtagaagatattatcagttcg
caacgtggctatgatgttgtttacaatggtgaaaagcatttttatgacggtgtattagtg
acagttccgcaccaaacatttatgcaatggttcagtgaagatccggcattagattatttt
aaaacaatggatagtacttcagttgcaactgttgtattagcttttgatgaaaaagatgtt
gaaaacacttatgatggtactggctttgtcatagcaagaacgtctgatacacgtattact
gcatgtacatggacaagtaaaaaatggccatttacgacaccggaaggcaaggtgttgttg
cgcgcttatgtaggtaagcctggtgatcatatcttagaagaaatgaatgatgaacaaatc
gtttctactgtgagaaaagatttgagccaaatgatgacaattaaaggtaatcctgaattt
tctattgtaaatagattacctaaaagtatgccgcaatatcatgtaggccacattcagcgt
attcgtgatattcaagcacatattcgtcaaacctatcctcatttaagaataacaggagca
gggtttgaagcggttggtttgcctgattgtatccagcaaggtaaagatgcagttgaagaa
ttagctgctaccgtgaaataa

DBGET integrated database retrieval system