KEGG   Staphylococcus carnosus: SCA_1834Help
Entry
SCA_1834          CDS       T00863                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00052  Galactose metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
Module
sca_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_1834
   00052 Galactose metabolism
    SCA_1834
Enzymes [BR:sca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCA_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAL28739
UniProt: B9DLS9
Position
complement(1837700..1838719)
Genome map
AA seq 339 aa AA seqDB search
MMFTRVEHQRNGLDLIKIDNDEAKIVFTNYGARIVSWKYEDNNIVLGNVVEADEFYQENP
FYFGASVGRYGGRIADGKFELDNQTYQLEQNDPPSHLHGGSNGIDRHLFDYEIKDENGGY
IQIIFTTTIKEADDHYPGDIKLKIIHTYDIDNRWSIEYYAESDQTTLFNPTNHVYFNLNR
DNKEVDNHYFTSDKLNIHLLNDQNLPEAAATLDLVNLFNKNKIRLTEMFESENARLNEQM
ETYKGLDHPFSIGDELIVENSQFLLKMKTDMPNVVVFTFNDTSSWKSDMNIYKAHSGFTL
ETQNLPNDINLFGKDAPSILQKDQAYYSRTTYQIIEKLM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttacaagagtggagcaccaaagaaacggactcgatttaatcaaaattgataat
gatgaagcaaagattgtatttacgaattatggggcaagaattgtatcttggaaatatgaa
gataacaatattgtcttaggaaatgtagtagaagcggatgaattctatcaagaaaacccc
ttttattttggcgcatctgtaggccgttacggcggtcgaattgcagacggcaaatttgaa
cttgataatcaaacgtatcaattagagcaaaatgatccgccgagtcacttgcatggtggc
tcaaatggtattgaccgtcatttatttgattatgaaatcaaagatgaaaatggcggatat
atacaaattattttcacgacaaccattaaagaggcagacgatcattatccgggagatatt
aaattaaagattatacatacgtatgatatcgataaccgatggtctattgaatactatgct
gaatctgatcaaactacattattcaatccgacaaatcatgtctatttcaatttaaatcgg
gataataaagaagtagataatcattattttacaagtgataagttaaatattcatttactc
aatgaccagaatttaccagaagcagcggcaacattagatttagtaaatctatttaataaa
aataaaattcgtttgactgagatgtttgaaagtgaaaatgctagacttaatgaacaaatg
gaaacatataaaggtttagaccatccgttttctatcggagatgaattaattgtagaaaac
agtcaattccttttgaaaatgaagacagatatgccgaatgtggtcgtattcacatttaat
gacacaagtagttggaaaagtgatatgaatatctataaagcacattcaggttttacctta
gaaacacaaaacttaccaaatgatattaacctatttgggaaagatgcaccgtcaatttta
cagaaagaccaagcatattattctagaacaacgtatcaaatcattgaaaaactgatgtaa

DBGET integrated database retrieval system