KEGG   Staphylococcus carnosus: Sca_1912Help
Entry
Sca_1912          CDS       T00863                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sca  Staphylococcus carnosus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sca_1912 (gpmA)
   01230 Biosynthesis of amino acids
    Sca_1912 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sca_1912 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Sca_1912 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sca_1912 (gpmA)
Enzymes [BR:sca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sca_1912 (gpmA)
Exosome [BR:sca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sca_1912 (gpmA)
  Exosomal proteins of melanoma cells
   Sca_1912 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1917289..1917975)
Genome map
AA seq 228 aa AA seqDB search
MPTLILCRHGQSVWNAENLFTGWTDVDLSDQGVEEATTSGDRLKQEGIEIDVAFTSVLQR
AIKTTYHLLERSNQLFVPLYKSWRLNERHYGGLQGLNKDAAREEFGEEQVHIWRRSYDIA
PPDATAEQREADLADRKYQGLDERVIPTSESLKDTLERVIPYWNDAIAPELLTGKTVLVS
AHGNSLRALIKHIEGVSDEDIVGYEIKTGAPLIYELDDNLGFVSKHYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaacattaatattatgccgacacggacaaagtgtttggaatgctgaaaatctattt
acaggatggactgatgttgatttatcagaccaaggtgtagaagaagcaactacttcaggt
gatcgtttaaaacaagaaggaattgagattgatgttgcttttacatctgttttacaacgc
gcaattaaaacaacatatcacttattagaacgttcaaatcaattatttgtacctctttat
aaaagttggcgtttaaatgaacgtcattacggcggattgcaaggattaaataaagatgca
gcacgtgaagagttcggtgaagaacaagtgcatatttggcgtcgttcttatgacatcgca
cctcctgacgctacagctgaacagcgagaagcagatttagctgatcgtaaatatcaaggg
ttagatgaacgtgttatcccaacatctgaaagtttaaaggatacattagaacgtgttatt
ccatattggaatgatgcaattgcccctgaattattaacagggaaaacagtattagtatct
gcacatggcaactcattgcgtgcattaatcaaacatatcgaaggtgtatcagatgaagat
atcgtaggatacgaaatcaaaacaggtgcgccacttatctatgaattagatgataattta
ggatttgtatcgaaacattatttataa

DBGET integrated database retrieval system