KEGG   Staphylococcus carnosus: Sca_1964Help
Entry
Sca_1964          CDS       T00863                                 

Gene name
fbp
Definition
putative fructose-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sca  Staphylococcus carnosus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sca01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sca00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sca00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sca00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sca00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976756..1978708
Genome map
AA seq 650 aa AA seqDB search
MKTTDRELKHKYFDLLAEKFNHEEQLATEIISLESILELPKGTEHFVSDLHGEYDSFQHV
LRNGSGNVRTKVNDIFQNTMSNQEISDFTALIYYPEDKLKLVKSSFDAKQPLNRWYEETI
EQMIQMILYSASKYTRSKLRKALPKQFVFIIEELLYKNNGLDNKTPYYNTLMNQIIETQQ
ADDLIIGMSYTIQRLVVDHLHVVGDIYDRGPEPEKIVETLIDYHSVDIQWGNHDAIWIGA
YAGSKVCLANILRICARYDNLNIVEDAYGINIRPLLNLAEKFYGDNPAFRPKLRSDSNLS
EQEQLQITKIHQAIAMIQFKLEIPIIKRRPSFEMEDRLVLEHVDYDNLTYTLHGKTHDLT
DTCFVTVDPEDPAKLLPEEQEVIDKLLISVQESEKLKRHMTFLMDKGCLYLPYNGNLLIH
GCIPIDENGKMEGMEIDGEFYSGRQLLDQFEKYMRKAFRHKDVTDDLATDLVWYLWTGKY
SSLFGKRAMTTFERYFIKDKATHKEEKNPYYSLRENPEIVGHLLEEFGLDPDQGHIINGH
TPVKEIDGEDPIKADGKMIVIDGGFSKVYQSTTGIAGYTLLYNSYGMQLVAHQHFNTKEN
VLRYGADELSTKRVVDEELTRKRIRDTNKGQLIQEEIDNLKDLMAHRYFE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccacagatcgtgaacttaaacataaatactttgacttacttgcagaaaaattt
aatcacgaagaacaactcgctacagaaatcatcagtctagaatctatcttagagttgcca
aaaggcactgaacactttgtcagtgatttacatggagaatatgattctttccaacatgta
ttaagaaatggttcaggcaatgtacgtactaaagttaatgacattttccaaaatacaatg
tccaatcaagaaatcagtgatttcactgctttaatctattatccagaagataagttgaaa
ttagttaaatctagttttgatgctaaacagcctttaaatagatggtatgaagaaactatc
gaacaaatgattcaaatgattttatattcagcttcaaaatacacgcgttctaaattacgt
aaagcattgccgaaacaattcgttttcattattgaagaactgctttataaaaataacggt
ttagacaataaaacaccttattacaatacattgatgaatcaaattatcgagacacaacaa
gcagatgatttaatcatcggcatgtcttatactattcaacgtttagtcgtcgaccacctt
catgtagtcggtgatatttatgaccgtggtccagagcctgaaaaaatcgttgaaacttta
attgattaccattctgtagacatccaatggggcaaccacgatgcaatttggatcggtgct
tatgcaggttctaaagtttgtttagccaatatcttaagaatttgtgcacgttacgataac
ttaaacattgtcgaagatgcttatggtatcaatatacgtccgctgttaaaccttgcagaa
aaattttacggagacaatccggcatttcgtcctaaattacgttctgattcaaatttatca
gaacaagaacaactgcaaatcaccaaaattcaccaagccatcgccatgatacagttcaaa
ttggagattccaatcattaaacgccgtccttcattcgaaatggaagatcgattagtatta
gaacatgttgattatgacaatttgacttatacattgcacggtaaaacacatgatttaaca
gatacatgttttgtgacagtagaccctgaagatcctgcaaaattattgccagaagaacaa
gaagtaatagataaattattaatttctgttcaagaatctgagaaattaaaacgacatatg
acattcttaatggataaaggttgtctttacttaccttataacggcaatctccttatacat
ggctgtattccaattgatgaaaacggcaaaatggaaggcatggaaattgatggagaattt
tattctggccgtcaattgcttgatcaattcgaaaaatatatgcgtaaagcattccgccat
aaagatgttacagatgatttagcaactgatttagtatggtatttatggacaggcaaatat
tcttcactattcggcaagagagcgatgacgacttttgaacgttatttcataaaagataaa
gcaacacacaaagaagaaaaaaatccttattattctttacgtgaaaacccagaaatcgtc
ggtcatttattagaagaattcggattagatccagatcaaggccatattattaacggtcat
acaccagtcaaagaaattgatggtgaagatcctatcaaagcagacggtaaaatgattgtc
attgatggcggtttttcaaaagtgtatcaatccacaacaggtattgccggctatacttta
ctttataattcatatggtatgcagctggtagcacatcaacacttcaatactaaagaaaat
gtattgcgttatggtgcagatgaattatcaacgaaacgtgtcgtagatgaagaattaaca
cgtaaacgcatccgtgatacaaataaaggacaattaatccaagaagaaattgataactta
aaagatttaatggcacatcgctattttgaataa

DBGET integrated database retrieval system