KEGG   Staphylococcus carnosus: Sca_1965Help
Entry
Sca_1965          CDS       T00863                                 

Gene name
lacH
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sca  Staphylococcus carnosus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sca_1965 (lacH)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sca_1965 (lacH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sca_1965 (lacH)
Enzymes [BR:sca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sca_1965 (lacH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1978764..1981778)
Genome map
AA seq 1004 aa AA seqDB search
MKLDLHYNLKQLHVNTLPYTNYFVPYHRKTEVHDNKKDLDKACVTPLNGDWNFDYYESVK
EYEAASTKKSKGELPVPGVWNLFGYDQIQYVNIKYPIPFDPPNVPEENPCGLYRRQFELN
KLYKKKERQYILNFDGVSSAYYVWVNQKFVGYSQVSHSISRFDITDFVKGGRNSIAVLVV
KYSDGTYLEDQDMFRHSGIFRDVYIVERPEARIEDFKIDTKVDTVENTGEILIDIRKIAG
DPSIEYALYNPNKKVIKRGEVGDERQIVIPLSQPELWSAETPNLYTLYLITKDEVIKQKI
GVREVKIEDQQLWINGQSVKLRGVNYHDTDPLQGYVVSEQRLITDLKLMKEANFNAIRTA
HYPKSPYFYELADKYGFYVMSEADLETHGVVMLYGKENIDDFNIIADNPKYEKAILDRVE
ASIVQLQNYSSIIMWSLGNESGYGQNFKKAAALAHDLDDTRPVHYEGAFYARGGEDYSKL
DVISRMYPSPEEIERRYLDNKQVTKPFILCEYAHAMGNSPGGLEAYHDLMEKYPAFIGAF
VWEWCDHAVTAGMQHGLYRFRYGGDSGETLHDGNFCVDGIVNPDRIPHEGFYEFQEIHRP
LVLKKYDGLTWTVRNQLDFLNINQFIEAAVSLTTIGGESKKFSFELPELLPHEEREIDFT
SILKDSHFKPEELSSIMLTYRLKSATGLLSAKTYLGHDQVIYQRQVINKVEDRNAPITEQ
AAINISANSISVQLKEWEYHFDKKTAALNLIKHNNKRLLDEPTKIVIWRAPTDNDIHLEE
RWKEMGYFNPITRILGYSIDEQDNRIIISFDIGFYSTNTPKILSVDCKWTIYPGGHIEVD
MHMERNMRMPALPRFGMIWKLQKEYEKIRYYGNGPFSSYSDKNLACHLGWFNTTVDENFR
PHIRPQEDGSHDNVTSMSIKSPDKEIRFSAEEPFSFNAKHYSDEQMTMIKHNDKLQKEPY
SFVHIDAVQSGIGTHSCGPELPKRYQVNGHTYNLNYSIDFKDFI
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagacttgcattataatttaaaacagttacatgtgaatacattaccttataca
aattactttgttccatatcatagaaaaactgaagtacatgacaataaaaaagatttagat
aaagcatgtgtaacgcctttaaatggtgattggaactttgattattatgaaagtgtaaag
gaatatgaagcggcttcaactaaaaaaagtaaaggagagctgcctgttcctggtgtttgg
aatttatttggttatgatcaaatacagtatgtgaatattaaatatccaattccgtttgac
cctccgaatgttcctgaagaaaatccttgcggtttgtatcgacgccagtttgaattgaat
aaactatacaagaagaaagaacgtcaatacattttgaattttgatggagtcagcagtgcc
tattatgtatgggtgaatcaaaaattcgtaggatacagccaggtctcacattctatttct
cgttttgatatcacagattttgtaaaaggcggcagaaattcaatcgctgttttagttgtg
aaatattcagatggtacttatttagaggaccaagatatgtttcgtcattcaggcatcttc
agagatgtttatattgtagaaagaccagaagcgagaattgaggatttcaaaattgatact
aaagtagatacagtcgaaaacacaggtgaaatacttattgatatacgaaaaatagcaggt
gacccttcgattgaatatgcattatataatcctaataaaaaggttataaaaagaggggaa
gtgggtgatgaaagacaaattgtaataccgctttctcaacctgaactttggtcagctgaa
acacctaatttgtacacattgtatctcattactaaagacgaagttattaagcagaaaatc
ggcgtacgtgaggttaagatagaagatcagcaattatggattaatggtcaaagtgttaaa
ttaagaggggtgaattatcacgacaccgatccgcttcaaggttatgtcgtctcagaacaa
cgcttgattaccgatttgaaattgatgaaagaagcgaactttaacgcaatccgtacggca
cactatcctaaatccccttatttttatgaattagcagataaatatggtttttatgtgatg
agtgaagcggatttagaaacccatggtgtggtcatgttatatggaaaagaaaatatagat
gattttaatatcatcgcagataaccctaaatatgaaaaagcaattttagatagagtagaa
gcctcgattgttcaattgcaaaattattcatctattattatgtggtcattgggcaatgag
tcaggttatggtcaaaatttcaaaaaagcagcagcactcgcgcatgatttagatgataca
agacctgtgcactatgaaggtgcattttatgcaagaggcggagaagattatagcaaattg
gatgttatcagccgaatgtatccttcaccagaagagattgaaagacgttatttagacaac
aaacaagtaacaaagccttttattctatgcgaatatgcacatgcgatgggaaattcacca
ggaggattagaagcatatcacgacttgatggaaaaatatcctgcatttattggcgcattt
gtttgggaatggtgtgaccatgcagtcacagctggtatgcagcatggattgtaccgtttc
agatatgggggagattcaggagagactttacatgatggtaatttttgtgttgacggcatt
gttaaccctgacagaattccgcatgaaggattttatgaattccaagaaattcatcgtcct
ttggtattgaaaaaatatgatggattaacttggacggttcgaaaccagcttgattttctg
aatataaaccaatttatagaggcagctgtttcactgactacaattggtggcgaaagtaag
aaattttcgtttgaactgcctgaactattaccgcatgaagaaagagaaatcgattttact
tcaatcttgaaagatagtcattttaaacctgaagaattgagcagtattatgctgacgtat
cgtttgaaatctgcgacaggcttattaagtgctaagacttatcttggacatgatcaagtc
atctatcaacgtcaggttattaataaagtagaagatcgaaatgctccaattacagaacaa
gcagcaataaatataagcgcaaatagtatctcggtacaacttaaagaatgggaatatcat
tttgataaaaaaacggcggcacttaatttgattaaacataataacaagcgtttgttggat
gaacctacaaaaattgtgatatggcgtgcaccgacagacaatgatattcatcttgaagaa
agatggaaagaaatgggatatttcaatccaattacacgcatacttggttatagcattgac
gaacaagataacagaataatcatctcgtttgatatcggtttttatagtaccaatacacct
aaaattttatccgtagattgcaaatggaccatttatcctggcggtcatattgaagtagat
atgcatatggaacgtaatatgcgtatgcctgcgttgccgcgctttggcatgatttggaaa
ttacaaaaagaatatgaaaaaatacgatattatggcaacggacctttcagcagttatagc
gataaaaatttggcttgccatttaggctggttcaatacaacagtagatgaaaatttcaga
ccgcacatacgtcctcaagaagatggcagccatgataatgtcacttctatgagtataaaa
agcccggataaggaaattcgattttcagctgaagaaccatttagttttaatgcgaaacat
tattcagatgagcaaatgacaatgataaaacataacgataaattacaaaaagaaccttat
tcatttgtgcatatcgatgcagtgcaaagcggaataggtacgcacagttgcggacctgag
ctgcctaagcgctatcaagtgaatggccacacatataatctgaattacagtatcgatttt
aaagattttatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system