KEGG   Staphylococcus carnosus: Sca_2025Help
Entry
Sca_2025          CDS       T00863                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sca  Staphylococcus carnosus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sca_2025 (gtaB)
   00052 Galactose metabolism
    Sca_2025 (gtaB)
   00500 Starch and sucrose metabolism
    Sca_2025 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    Sca_2025 (gtaB)
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sca_2025 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2036209..2037075)
Genome map
AA seq 288 aa AA seqDB search
MSKIKKAVIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGKH
KRAIEDHFDNQMELESNLREKGKDELLEKVQHSTQLANIFYVRQREQKGLGHAIWTARQF
IGNEPFAVLLGDDIVESDNPAIKQLMDVYDETNKSVIGVQTVPESETHRYGIVKPEKQDG
RLYEVEKFVEKPAPGTAPSNLAIMGRYVLKPEIFDYLSTQDKGSGGEIQLTDAIERLNQD
DQVYAYDFEGHRYDVGEKTGFVKTTIAYALKDAEMKDEIKDYIKNLEL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagattaaaaaagcagttataccagcagcaggtttagggacacgttttttacct
gcaactaaggcaatgcctaaggaaatgttgccgatattagataagccgacgattcaatat
attgttgaagaggctgcacgtgcaggtatcgaagatattattattgtgacaggtaaacat
aaacgtgccattgaagatcattttgataatcaaatggaacttgaaagtaatttgcgtgaa
aaaggaaaagatgaattgcttgaaaaagttcaacattccacacaactcgcaaatattttc
tatgtacgccaacgtgaacaaaaaggtttaggtcatgcgatttggacagcacgtcaattt
attggcaacgaaccatttgctgtgttattaggtgatgacattgttgaatcagataatccg
gcaattaaacaattaatggatgtttacgatgaaacgaataaatctgtaattggtgtacaa
actgttccagaaagtgaaacacatcgttatggtattgtaaaacctgaaaaacaagatgga
cgtttgtatgaagttgaaaaattcgtagaaaaaccagcaccaggtactgcaccatctaat
ttagcgattatgggccgttatgtcttaaaacctgaaatctttgattatttatcaacacaa
gataaaggcagcggcggtgaaattcaattaacagatgcaattgaacgtttgaaccaagat
gatcaagtatatgcatatgattttgaaggtcatcgttatgatgtgggtgaaaaaactggt
tttgttaaaacaacaattgcttatgcattaaaagatgctgaaatgaaagacgaaattaaa
gattatattaaaaacttagagttatag

  All links  
No link information was found.   
DBGET integrated database retrieval system