KEGG   Staphylococcus carnosus: Sca_2179Help
Entry
Sca_2179          CDS       T00863                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sca  Staphylococcus carnosus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sca_2179
   00052 Galactose metabolism
    Sca_2179
   00500 Starch and sucrose metabolism
    Sca_2179
   00520 Amino sugar and nucleotide sugar metabolism
    Sca_2179
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sca_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2207638..2208273)
Genome map
AA seq 211 aa AA seqDB search
MNLESNGKFKELEKTKEPTNLVNLFYVRQKEQKGLGDAVLCAKQFIGNEPFAILLGDDIV
KGETPAIKQLMQKYEETGKSVIGVQEVQPSETHRYGIINPISSNGRLYQVNNFVEKPKEG
TAPSNLAIMGRYVLSPQIFNYLENQGIGAGGEVQLTDAIERLNQDDNVFAYDFEGKRYDV
GEKIGFVKTTIDFALNNDDMKDEITKFLKNL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaatctaacgggaagtttaaagaattagaaaaaacaaaagagcctaccaat
ttagtgaatcttttttatgtacgtcaaaaagagcaaaaaggtttgggagatgcagtatta
tgcgcaaagcaatttattggaaatgaaccttttgccattttattaggagacgatattgtt
aaaggtgaaactccagcaatcaaacagttaatgcaaaaatatgaagaaactggcaaatca
gtgattggagtacaagaagttcaaccttcggaaacacatagatatggaattataaatcca
atttcttcaaatggacgattatatcaagtaaacaattttgtagaaaagccaaaagaagga
actgcaccatcaaatttggcaattatgggaagatatgttctttcaccacaaatcttcaac
tatcttgaaaatcaaggaattggcgcaggtggagaggtacagctcacggatgctatagaa
agattaaaccaagatgataacgtattcgcatatgactttgaaggtaagcgttatgatgta
ggagaaaaaattggatttgtaaaaacaacaattgattttgctttgaataacgatgatatg
aaagacgaaataacaaaatttttaaaaaatctgtaa

DBGET integrated database retrieval system