KEGG   Staphylococcus carnosus: Sca_2180Help
Entry
Sca_2180          CDS       T00863                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sca  Staphylococcus carnosus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sca_2180
   00052 Galactose metabolism
    Sca_2180
   00500 Starch and sucrose metabolism
    Sca_2180
   00520 Amino sugar and nucleotide sugar metabolism
    Sca_2180
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sca_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2208305..2208493)
Genome map
AA seq 62 aa AA seqDB search
MIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAAEAGIEGVIIITGKHKK
SY
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcaataatacctgctgcagggctaggaacaagatttttgcctgcaact
aaagcaatgccaaaagaaatgttaccaatattagataaaccaactatccaatatattgtg
gaggaagctgcagaagctgggatagaaggtgtgattattattactggaaaacataaaaag
agctattga

DBGET integrated database retrieval system