KEGG   Staphylococcus carnosus: SCA_2180Help
Entry
SCA_2180          CDS       T00863                                 

Definition
(GenBank) truncated UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sca  Staphylococcus carnosus
Pathway
sca00040  Pentose and glucuronate interconversions
sca00052  Galactose metabolism
sca00500  Starch and sucrose metabolism
sca00520  Amino sugar and nucleotide sugar metabolism
sca01100  Metabolic pathways
sca01130  Biosynthesis of antibiotics
Module
sca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCA_2180
   00052 Galactose metabolism
    SCA_2180
   00500 Starch and sucrose metabolism
    SCA_2180
   00520 Amino sugar and nucleotide sugar metabolism
    SCA_2180
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCA_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAL29085
UniProt: B9DJT4
Position
complement(2208305..2208493)
Genome map
AA seq 62 aa AA seqDB search
MIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAAEAGIEGVIIITGKHKK
SY
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcaataatacctgctgcagggctaggaacaagatttttgcctgcaact
aaagcaatgccaaaagaaatgttaccaatattagataaaccaactatccaatatattgtg
gaggaagctgcagaagctgggatagaaggtgtgattattattactggaaaacataaaaag
agctattga

DBGET integrated database retrieval system