KEGG   Staphylococcus carnosus: SCA_2259Help
Entry
SCA_2259          CDS       T00863                                 

Gene name
acsA
Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00620  Pyruvate metabolism
sca00640  Propanoate metabolism
sca00680  Methane metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_2259 (acsA)
   00620 Pyruvate metabolism
    SCA_2259 (acsA)
   00640 Propanoate metabolism
    SCA_2259 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SCA_2259 (acsA)
Enzymes [BR:sca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SCA_2259 (acsA)
Lipid biosynthesis proteins [BR:sca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SCA_2259 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAL29162
UniProt: B9DJ88
Position
2320571..2322160
Genome map
AA seq 529 aa AA seqDB search
MNKPDLVEPRNFNIVSEIEKYAKDESKVAIIFEDDAGEETKVTYADLIRKSNRMGNLFKQ
HGLKKGDTLLIKMERSIETYEVYIAALKLGVSLIPASEMLRTKDLQYRITHGEVDAVLSI
ASGADEFEGVNEYDDLTKFIIGGQKDGWVDVDKDVQNQSDELEIVDTDRDDVAFLPYTSG
TTGNPKAVVHTHGWGYAHMQMAPKHWLNIHEDDIVWATAAPGWQKWVWSPFLSTMTSGAT
AFVYNGRFDGTKYLELLQDYQINVLCCTPTEYRIMAKLQNLDHFDLSHLHDAVSAGEPLN
QEVVEKFQNTFNITVRDGYGQTESTLLIGLLKDVPGRPGSMGKAIPGSDVLIVDDEGQPV
EPGIVGNIAVPVDLPALFKGYFKDPERTQERVAGDYFLTGDRAKVDEDGYFWFEGRADDI
IISSGYTIGPFEVEDSLTKHPAVKETAVVASPHELRGNIVKAFVILQDSYEESDELVREL
QNFVKYDVAPYKYPRAIEFVEELPKTNSGKIRRVELREAEIEKYNHEHE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaccagatttagtcgaacctcgcaatttcaatattgtatctgaaattgaaaaa
tatgcgaaagatgaatcaaaggttgcgataatttttgaagatgatgcgggtgaggaaaca
aaagtaacgtatgcagacttaatccgcaaatcaaaccgtatggggaatttgtttaaacaa
cacggtttgaaaaaaggggacacactgcttatcaaaatggaacgcagtatcgaaacatat
gaagtttatattgccgcattgaagttaggtgtatcgctgatccctgcttctgaaatgctg
cgtacgaaagatttacaatatcgaattacacatggtgaagtagatgcagtattatctatc
gcatctggtgcagatgaattcgaaggtgtaaatgaatatgatgatttaacaaaatttatt
atcggcggtcaaaaagatggctgggtagatgtcgataaagatgtacaaaatcaaagcgat
gaacttgaaattgtagacactgatcgtgatgatgtggcgttcttgccttatacatctgga
acaacaggcaacccgaaagcagtagtacatacgcatggttggggttacgcccatatgcaa
atggcaccgaaacattggttgaacatccatgaagatgacattgtatgggctacagctgcc
cctggttggcaaaaatgggtttggagtcctttcttatctacaatgacttctggagccact
gcgttcgtctataacggccgttttgatggcacaaaataccttgaactacttcaagactat
caaatcaatgttttatgctgtacaccgactgaataccgtattatggctaaattgcagaat
ttagatcattttgatttatctcatttgcatgatgctgtatctgcaggtgaaccgcttaac
caagaagtggtagaaaaattccaaaatacatttaatatcacagtacgtgacggttatggt
caaactgaaagtacattgcttatcggtttgctgaaagatgtgcctggacgtcctggttca
atgggaaaagctattcctggcagcgatgtcttaatcgttgacgatgagggacagccggta
gaacctggtattgtaggtaatattgcagtgcctgtagatttacctgccttgttcaaaggc
tatttcaaagatccagaacgtacacaagagcgtgtcgcaggcgattatttcttaacaggc
gaccgtgcaaaagttgatgaagacggctatttctggtttgaaggtcgtgcagacgatatt
attatcagctctggttacacaattggaccatttgaagtcgaagactcgttaacaaaacat
cctgcagttaaagaaacagcagttgtcgctagtccgcacgagctgcgcggtaatattgtt
aaagcatttgttatcttgcaagacagttatgaagaaagcgatgaattggtacgtgaactt
caaaactttgtaaaatacgatgtagcaccttataaatatccacgtgccattgaatttgtt
gaagaattgcctaagacaaactctggtaaaatccgtcgcgtagaattgcgtgaagcagag
attgaaaaatataatcatgaacatgaataa

DBGET integrated database retrieval system