KEGG   Staphylococcus carnosus: Sca_2372Help
Entry
Sca_2372          CDS       T00863                                 

Gene name
adhC
Definition
putative alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sca  Staphylococcus carnosus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sca_2372 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sca_2372 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    Sca_2372 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sca_2372 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sca_2372 (adhC)
   00626 Naphthalene degradation
    Sca_2372 (adhC)
Enzymes [BR:sca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sca_2372 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2442766..2443893)
Genome map
AA seq 375 aa AA seqDB search
METKAAVLYEMGLEVPYKDSKPLKVETLQLESPKNHEVLIKVHAAGLCHSDLSVINGSRP
RPMPMALGHEAAGEIIEVGKEVTQFEVGDHVVCTFIPSCGHCIPCREGRPALCENGAESN
EKGEMLEGGRRLSKDGKPINHHLGVSGFSDYAVVSENSIVKIDSSIPFERAAVFGCAVIT
GIGAVINTAQIRPGSNVAIVGLGGIGLNAILGAKLAGANEIIALDINENKFNLAKTLGAT
VVFNSGDEDIVEKIKDYVSGGVEYAFETAGVVPAMQTAYAITKRGGTTVTTGLPDPKAQF
SFPQVTLAAEERTIKGSYVGSCVPDRDIPRFVSLYQQERLNIDPLISKTISLDEINEGFD
QLASGDVGRLIIKMQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagccgctgtattatatgaaatgggattagaagtaccttataaagattca
aaaccgcttaaagttgaaacattgcaattagagtctccaaaaaatcatgaagtccttatt
aaagttcatgcagcaggattatgtcattctgacttatctgtgattaacggaagcagacca
agacctatgcctatggcgttagggcatgaagccgctggagaaattattgaagtaggaaaa
gaggtcacacaatttgaagtgggtgaccatgttgtatgcacattcatcccgagttgtggt
cattgcataccatgtagagaaggaaggccggctttgtgtgaaaatggcgcagaatccaat
gaaaaaggagaaatgctcgaaggaggacgtcgtttatctaaagacggtaaacctattaac
caccacttaggcgtttcaggtttttctgattatgctgtcgtatcggagaattcaattgtg
aagatagattcatctattcctttcgaacgagcagctgttttcggatgcgcggtcattact
ggtataggagctgtaataaatacggctcaaatcagacctggaagtaacgtagctattgtt
ggtctaggaggaattggtttaaacgcaatcttaggtgcgaagctagcaggtgcaaatgaa
attattgccttagatattaatgaaaataaattcaatctagctaaaacattaggggcaact
gttgtttttaattcaggagatgaagatatagttgaaaagattaaagattatgtatctggt
ggtgttgaatatgcatttgaaacagcaggagtagtgccggcaatgcaaactgcatatgct
attactaagcgaggcggtactactgtaacaactggactacccgatcctaaagcacaattt
tctttcccacaagtaactttagcggcagaagagcgtacaataaaaggatcttatgttgga
agttgtgttcctgatagagatataccaagatttgtaagcttatatcagcaagaaagactt
aatatcgatccgcttatcagtaaaacgatatcgctagatgaaataaatgaaggttttgat
caattagcaagcggagacgtagggcgtttaattataaaaatgcaataa

DBGET integrated database retrieval system