KEGG   Staphylococcus capitis: AYP1020_2323Help
Entry
AYP1020_2323      CDS       T03970                                 

Gene name
yhfS
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase YhfS
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scap  Staphylococcus capitis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:scap00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYP1020_2323 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    AYP1020_2323 (yhfS)
   00640 Propanoate metabolism
    AYP1020_2323 (yhfS)
   00650 Butanoate metabolism
    AYP1020_2323 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    AYP1020_2323 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    AYP1020_2323 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYP1020_2323 (yhfS)
   00310 Lysine degradation
    AYP1020_2323 (yhfS)
   00380 Tryptophan metabolism
    AYP1020_2323 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYP1020_2323 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYP1020_2323 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AYP1020_2323 (yhfS)
Enzymes [BR:scap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYP1020_2323 (yhfS)
Exosome [BR:scap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYP1020_2323 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2384798..2385934
Genome map
AA seq 378 aa AA seqDB search
MKQPVIVAAKRIAFGKYGGYLKHLEPEQLLKPLFNYFQAEYPGAMEYLEDVIIGNTVGNG
GNIARKSLLEAGLKNSVPGVTIDRQCGSGLETIIQACRMIQSGAGNVYLAGGVESISRAP
WKLKRPQSVYETEFPQFFERAPFAPEGQDPSMIEAAENVARKYGISRVMQDKFAYRSHQL
TQGNYDNGNISREILPIKVKGVSFDRDESVKSRLTTEKLSRFKPLLNQGSITVGNSCMKN
DGAVLILVMEEKLAINLGFAKGLKFIESCTVGVDPNYLGIGPVPAVRKLLKRAKVKIEDI
DTIELNEAFSSQVLACQKELSISDDKLNRWGGAIASGHPYGASGAALVTRLFHMNVQNKS
IATMGIGGGLGNAVLFER
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaccagtcattgtagcagctaaacgaattgcatttggcaagtacggtggatat
ttaaagcatttggaaccagaacaactactaaaacctttattcaattactttcaagcagaa
tatcctggagcgatggaatacttggaagacgttattatcggcaacacagttggcaatggt
ggtaacatcgcaaggaaatctttgctagaagcaggccttaaaaactccgttccaggcgtt
actattgatcgacagtgtggttcagggctagaaactattatacaagcttgtagaatgata
caaagtggcgctggaaatgtataccttgcaggtggtgttgagagtataagtagagcacct
tggaaattaaaacgacctcaatcagtgtatgaaacagaatttcctcaattcttcgaaaga
gcgccatttgctccagaaggtcaagatccttcaatgatagaagctgctgaaaatgtggcg
cgtaaatacggtatttcgcgagtaatgcaagataagttcgcttatagaagccatcaattg
actcaaggtaactatgataatgggaatatttcccgagaaatattgcctattaaagttaaa
ggggtatcgtttgatagagatgaaagtgttaagtctcgtttaactactgagaaattaagt
agatttaaaccattattaaatcaaggttcaattacagttggtaacagttgtatgaaaaat
gatggtgccgtattaatccttgtaatggaagagaaactcgctataaacttaggttttgct
aaaggattaaaatttattgaaagttgtacagttggggttgatcctaattatttaggtata
ggtcctgtgccagcagttagaaagctgttgaaaagagctaaagttaaaatagaagatatt
gatactatagaattaaatgaagcatttagttcacaggttttagcttgtcagaaggaactt
agtatttctgatgataagctaaatcgatggggtggcgcaatcgcttctggtcacccatat
ggagcaagtggcgctgctctagttacacgattatttcatatgaatgtgcaaaataaatcc
attgcaacaatgggaatcggtggaggactcggtaatgcagtattatttgagagatag

DBGET integrated database retrieval system