KEGG   Streptomyces scabiei: SCAB_10061Help
Entry
SCAB_10061        CDS       T01187                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
scb  Streptomyces scabiei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136099..1138063
Genome map
AA seq 654 aa AA seqDB search
MRSRIRRRIHPAGPMVLALAAAGSVLAGPALPASASGPATRADLRADVNRDGRIDVSGDT
DTSGEDGWSVSRGAVHLPNLDDDTKRCPATGPGGKPLSDAKLAACNDASDTKVNGSADAA
DLARIRSLPLPGLPADAEGSLKVTAGTKHTHVFLKRSGTWTLVTSRTRLTAAELRSGVEF
GVEATDVIRDSARWDGRAVIRLTVKSGEGTSSDSVTLRTAPLLTQHHLQDTQQVMVTKVR
GEGEYGRLQRKFVKDLAREVKAAGVTAPLVTFTKYGDPWAQDFVEPAYVSMTGPGGRPQV
MRVMLRSAQLDRESGRELFERIRGRDIGVVQVTDPVPPADWSLNSMGNLETVPPYAHNGK
SYPAGRIIMGERKGSDIRPSKVMRTMLTSQGLQNPLLLDTSWLGVGHVDEFVQFLPADTP
RGWRIGLADPSAGLKLLRDAERAGHGSTKVFSVPRTKGAPAPKETIAQALASRHLVADNE
MAAERIAANLEILKRETGVTDGEIVRVPALYTRDVMEQAADGQSVPVPRLTRMGGGSALV
NSLKEHGQQKWLADNPAASRAKAPAPVMTSAYVPGAVNGVLLGRDRYLAPRQWGPVIGGK
DIFTEAVTAVYTRAGLKVSYIDDWYTYHLGQGEVHCGTNTLRDVSTAWWAGSAR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcacgcatacgtaggcgtatccaccctgccgggccgatggtcctggctctcgcg
gcagcgggatccgtgctggcgggccccgcactccccgcttccgcctcgggcccagccacc
cgggccgatctgcgcgcggacgtgaaccgcgacgggcggatcgacgtcagcggcgacacc
gacacatccggcgaggacggctggtccgtcagtcgtggagcggtgcacctgcccaacctc
gacgacgacaccaagcggtgccccgccaccggccccggcggcaaacccctgtccgacgcc
aagctggccgcctgcaacgacgcctcggacacgaaggtcaacggcagcgcggacgccgcc
gacctcgcccggatccggtccctgccccttcccggccttcccgccgacgccgaaggcagc
ctgaaggtcaccgcaggaaccaagcacacgcacgtctttctcaagcgctccgggacatgg
accctggtgacctcccggacccggctgaccgccgccgagctgcgctccggcgtggagttc
ggcgtcgaggcgaccgatgtcatccgcgacagcgcccggtgggacggcagggcggtgatc
cgcctgacggtgaagtcgggcgaagggacgtcgtccgactccgtcaccctgcgcaccgca
ccgctcctgacccagcatcacctccaggacacccagcaggtgatggtcaccaaggtccgc
ggcgagggcgaatacgggcgcctgcagcggaagttcgtgaaggacctggcgagggaggtc
aaggcagccggtgtcaccgcaccactggtcaccttcaccaagtacggagacccctgggcc
caggacttcgtcgaaccggcctacgtcagcatgaccgggccgggaggccgcccacaggtc
atgcgcgtgatgctgcgctccgcccagttggaccgggagtcgggccgggaactgttcgag
aggatccgcggccgggacatcggcgtcgtacaggtcaccgacccggtcccgccggccgac
tggtcactcaactcgatgggcaacctggagaccgtcccgccctacgcgcacaacgggaag
tcgtacccggccgggcgcatcatcatgggcgaacgcaagggcagcgacatacgcccgtcc
aaggtcatgcgcacgatgctgacgtcacagggcctccagaaccccctgcttctggacacc
tcctggctgggcgtcggacacgtcgacgagttcgtgcagttcctgcccgccgacaccccg
cgcggctggcggatcggcctcgccgacccgagcgccgggctgaagctgctgcgcgacgcc
gagcgcgccggacacggcagtacgaaggtgttctccgtcccccgcacgaagggcgctccc
gcccccaaggagaccatcgcccaggcgctcgcctcccggcacctcgtggccgacaacgag
atggcggccgagcgcatcgcggccaacctggagatcctcaagcgggagacgggcgtcacc
gacggcgagatcgtacgggtgcccgccctgtacacgcgtgacgtgatggagcaggccgcc
gacgggcagagcgttcccgtgccacgcctgacgcgcatgggcggcggctcggccctggtg
aacagcctcaaggagcacggccagcagaagtggctcgccgacaaccctgccgcctcgcgc
gcgaaggctccagcgccggtcatgaccagcgcatacgtgcccggcgcggtcaacggcgta
ctcctgggccgcgaccgctatctggccccccgccagtggggacccgtcatcggcggcaag
gacatcttcacggaagcggtcacggccgtctacacgcgagccggtctgaaggtgtcgtac
atcgacgactggtacacctatcacctcggccagggcgaggtgcactgcggcaccaacacc
ctgcgcgacgtgtcgaccgcatggtgggcgggctcggctcggtga

DBGET integrated database retrieval system