KEGG   Streptomyces scabiei: SCAB_12251Help
Entry
SCAB_12251        CDS       T01187                                 

Definition
glycosylhyrdolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scb  Streptomyces scabiei
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCAB_12251
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCAB_12251
   00600 Sphingolipid metabolism
    SCAB_12251
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCAB_12251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1378984..1381164
Genome map
AA seq 726 aa AA seqDB search
MRGSRAVTTRISLTGTTARPEHPGRGTALATVVEAAERSRVWSHPESGLYAVMDATGAVR
LGRPGQDWACLVPLVEVTATGHGRVWSGERFIETAIGERLTYRGHETVRDEGRERTTIRL
ADAATGLAADVTLETRPGSGHLRSQVRLANEGRTALRLESVSTVTLGGVVDSDGGLDGLT
LHWADNDWLAECRWRQDAFRARVVPLSRAAHGHEGRGCFERYSQGSWSTGRHLPVAGLTD
GTGRAWLWQIESSAGWRFETGEREGAAYVALFGPDDAHHQWHHTLAPGQEFRTVPAVLVH
AETGGLDAAFGELTDYRRGMRRDHPDLRTLPVIYNDYMNTLMGDPTTERLMPLIEAAAEA
GAEVFVIDAGWYDDAQGWWDAVGAWEPATRRFPGGLPEVLDAIRAHGMTPGLWLEPEVVG
VRSPLARSLPPEAFFRRGGLRVTEHGRHHLDLRHPAARGHLDTVVDRLVGEWGVGYLKLD
YNINIGPGTENGQESPGAGLLGHHRAHLAWMASLLDRHPGLVLENCGSGGLRMDYAQLAV
AQVQSTSDQQDFLRYPPIAAAAATAAAPEQAAVWAYPQPGQTLDEIAFTLTGALLGRVHL
SGFLNLMTDEQAALVRSAIRVYKDIRPEVARAHPFWPLGLPAWDDTWIAHGLRGRGSTFV
AVWRRGSASGDRTLVVPHLRGVHVEPEVLHSGPSEVSARWDAAEAALTVLLPRPDTAVLL
RLRAAP
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaggatcacgagcggtcaccacacggatcagcctcaccgggaccaccgcacgaccc
gaacatcccggaaggggaacggcgttggccactgtcgtcgaagcagccgagaggtctcgg
gtctggtcgcatccggagtccggcctgtacgccgtcatggacgccaccggggcggttcgg
ctgggcaggccgggccaggactgggcctgcctggtgcccctggtcgaggtcaccgccacc
ggtcacggacgcgtgtggtcgggagagcgcttcatcgagacggccatcggtgaacgcctc
acctaccgcgggcacgagacggtgcgggacgagggacgggagcgtacgacgatccggctg
gcggacgccgcgaccggcctcgccgccgacgtcaccctggagacacggccgggcagcggt
cacctgcgctcccaggtccgtctggccaacgagggccgcacggcactgaggctggagagc
gtctccacggtgaccctcggcggtgtggtggactcggacggcggtctcgacgggctcacc
ctgcactgggcggacaacgactggctcgccgaatgccggtggcggcaggacgccttccgc
gcccgggtggtcccgctctcccgggccgcgcacggccacgagggccggggctgcttcgag
cggtactcacaggggagttggtccaccggccgccatctgcccgtggccggcctcaccgac
gggaccggccgtgcctggctgtggcagatcgagtccagcgcgggctggcgcttcgagacc
ggggagcgcgagggcgcggcgtacgtggccctgttcggccccgacgacgcgcaccaccag
tggcaccacaccctggcgcccggccaggagttccgcaccgtccccgccgtcctggtccac
gcggagaccggcggactggacgcggccttcggtgaactcacggactaccgccggggcatg
cgccgtgaccatcccgacctccgcacgctgccggtgatctacaacgactacatgaacacc
ctgatgggagaccccaccaccgaacggctcatgccgttgatcgaggcggcggccgaggcc
ggtgccgaggtgttcgtgatcgacgcgggctggtacgacgacgcgcagggctggtgggac
gctgtcggcgcgtgggagccggcaacccgccgtttcccgggcgggctgccggaggtcctg
gacgccatcagggcgcacggcatgaccccgggactctggctcgaacccgaagtcgtcggc
gtacgcagtcccctggcccgcagtctgccgcccgaggcgttcttccgtcgcggcggcctg
cgcgtcaccgaacacggacggcaccacctggacctgcgccacccggccgcccgggggcat
ctcgacacggtcgtggaccggctggtcggcgagtggggggtggggtatctgaagctcgac
tacaacatcaacatcggcccgggcacggagaacggacaggagagcccgggagccggcctg
ctcggacaccatcgcgcccacctcgcctggatggcctcgctcctggaccgccaccccggc
ctggtcctggagaactgcgggtcgggcggtctgcgcatggactacgcccagctggcggtg
gcgcaggtgcagtccaccagcgaccagcaggactttctgcggtacccgcccatcgccgcc
gctgccgccacggcggcggcacccgaacaggccgccgtctgggcctacccccagccgggt
cagaccctcgacgagatcgccttcaccctcaccggggcgctgctcggccgggtgcacctc
tcgggcttcctcaacctcatgaccgacgagcaggccgccctcgtacgctcggcgatccgc
gtgtacaaggacatccggccggaggtcgcgcgggcgcaccccttctggccgctgggcctg
cccgcctgggacgacacctggatcgcgcacgggctccgcggccgcgggtccacgttcgtg
gcggtgtggcgcagaggctccgcgagcggcgaccgcacactcgtcgtgccccacctgcgt
ggcgttcacgtcgaaccggaggtactccactccggcccgtccgaggtgagcgcccggtgg
gacgcggccgaagcggctctcaccgtcctgctgccccgccccgacaccgcggtcctgctc
cggttgcgcgcggcaccgtag

DBGET integrated database retrieval system