KEGG   Streptomyces scabiei: SCAB_13351Help
Entry
SCAB_13351        CDS       T01187                                 

Gene name
fadB1
Definition
(GenBank) putative fatty acid oxidative multifunctional enzyme
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scb  Streptomyces scabiei
Pathway
scb00071  Fatty acid degradation
scb00280  Valine, leucine and isoleucine degradation
scb00281  Geraniol degradation
scb00310  Lysine degradation
scb00362  Benzoate degradation
scb00380  Tryptophan metabolism
scb00410  beta-Alanine metabolism
scb00640  Propanoate metabolism
scb00650  Butanoate metabolism
scb00903  Limonene and pinene degradation
scb00930  Caprolactam degradation
scb01040  Biosynthesis of unsaturated fatty acids
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
scb01212  Fatty acid metabolism
Module
scb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAB_13351 (fadB1)
   00650 Butanoate metabolism
    SCAB_13351 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_13351 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    SCAB_13351 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAB_13351 (fadB1)
   00310 Lysine degradation
    SCAB_13351 (fadB1)
   00380 Tryptophan metabolism
    SCAB_13351 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_13351 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAB_13351 (fadB1)
   00281 Geraniol degradation
    SCAB_13351 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAB_13351 (fadB1)
   00930 Caprolactam degradation
    SCAB_13351 (fadB1)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCAB_13351 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAB_13351 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCAB_13351 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DAO AlaDh_PNT_C NAD_binding_8 Pyr_redox_2 NAD_Gly3P_dh_N adh_short_C2 ApbA GIDA
Motif
Other DBs
NCBI-ProteinID: CBG68493
UniProt: C9Z865
Position
complement(1494552..1496726)
Genome map
AA seq 724 aa AA seqDB search
MTESTTIRWEQDRTGLVTLVIDDPNQSANTMNQAFRDSLAVITDRLEAEKDTIRGVIITS
AKKTFFAGGDLRDLIRVTPDTARQLFDGGLEIKRNLRRIETLGKPVVAAINGAALGGGYE
LALACHHRVALDAPGSKIGCPEVTLGLLPGGGGVVRTVRLLGIADALLKVLLQGTQYSPR
AALENGLIHEVASTRDELLDKARAFIDANPESQQPWDRPGHRIPGGTPSHPKFAANLPAF
PATLRKQTGGAPYPAPRAILAAAVEGAQVDFETAQVIEARYFVELAAGRTSKNMIQAFFF
DLQAVNSGANRPQGIEPRQVRKVAVLGAGMMGAGIAYSCARAGIDVVLKDVTPEAAAKGK
EYSEKLCARAVAKGRTTQDKADALLARITPTADPADLAGCDAVIEAVFENTELKHKVFQE
IEGVVAPDALLCSNTSTLPITELAEGVVRRSDFIGLHFFSPVDRMPLVEIIKGEQTGDEA
LARAFDLVRQIRKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRAESRRAVEEAGGTWVEHPADAVIDRMVDEFARPGRSGGAGF
YDYGPDGRRGKLWPGLREHFTRPGHRIPFEDMRERMLFAEALDTVRLLEEGVLTSVADAN
IGSLLGIGFPGWTGGVLQYINGYEGGLPGFVTRARELADRYGPRFTPPRLLLEKAEKGER
FSDG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaccaccatccgctgggaacaggaccgcacgggcctggtcaccctcgtc
atcgacgacccgaaccagtccgcgaacaccatgaaccaggcgttccgcgactccctcgcg
gtgatcaccgaccgcctggaggcggagaaggacaccattcgcggtgtcatcatcacctcc
gccaagaagaccttcttcgccggcggcgacctccgtgacctcatccgggtcacccccgac
accgcccggcagctgttcgacggcggcctggagatcaagcgcaacctgcgccgcatcgag
acgctcggcaagcccgtcgtcgcggcgatcaacggcgcggccctgggcggcggctacgaa
ctggccctggcctgccaccaccgcgtcgccctggacgcccccggctcgaagatcggctgc
cccgaggtcaccctcggcctgctgcccggcggcggcggtgtcgtgcgcaccgtccgtctg
ctgggcatcgccgacgccctgctgaaggtgctgctgcagggcacccagtacagcccgcga
gccgccctggagaacggcctgatccacgaagtggcctccacccgggacgagttgctggac
aaggcccgcgccttcatcgacgccaaccccgagtcgcaacagccctgggaccggcccggc
caccgcatccccggcggcaccccctcccacccgaagttcgcggcgaacctgcccgccttc
cccgccaccctgcgcaagcagacgggcggcgcgccctacccggccccgcgcgccatcctc
gccgccgccgtcgagggcgcccaggtcgacttcgagaccgcccaggtcatcgaggcgcgc
tacttcgtggagctggcggcgggccggacgtccaagaacatgatccaggccttcttcttc
gacctccaggccgtcaactccggcgcgaaccgcccccaaggcatcgagccccgccaggtc
cgcaaggtggccgtcctcggcgccgggatgatgggtgcgggcatcgcctactcgtgcgcc
cgcgcgggcatcgacgtcgtcctgaaggacgtgacgcccgaagcggcggcgaagggcaag
gagtactcggagaagctctgcgcccgagcggtcgccaagggccgcaccacgcaggacaag
gccgacgccctcctcgcccgcatcacccccaccgccgacccggccgacctcgcgggctgc
gacgcggtcatcgaggccgtgttcgagaacaccgagctgaagcacaaggtgttccaggag
atcgagggggtggtggcgccggacgccctgctctgctccaacacctccaccctccccatc
accgagctggccgagggcgtcgtgcgccggtccgacttcatcggcctgcacttcttctca
cccgtcgacaggatgccgctcgtcgagatcatcaagggcgagcagacgggagacgaggcc
ctggcccgcgccttcgacctcgtccgccagatccgcaagacaccgatcgtcgtcaacgac
tcgcgcggcttcttcacctcccgggtcatcgggcacttcatcaacgagggcgtcgcgatg
gtgggggagggcatcgagcccgcctcggtcgaacaggcggcggcccaggcgggctacccc
gccaaggtcctctccctcatggacgagctgaccctcaccctgccccgcaagatccgcgcc
gagtcccggcgggccgtggaggaggcgggcggcacctgggtggagcacccggccgacgcg
gtcatcgaccggatggtcgacgagttcgcccgccccggccgcagcggaggcgccgggttc
tacgactacggtcccgacggccgccgcggcaagctctggcccgggctgcgcgagcacttc
acccggcccgggcaccggatcccgttcgaggacatgcgggaacgcatgctcttcgcggag
gccctggacacggtccgcctcctcgaagagggcgtcctgacctccgtcgccgacgccaac
atcggctccctcctcggcatcggcttccccggctggaccggcggcgtcctgcagtacatc
aacggctacgagggcggcctccccggcttcgtgacccgggcccgggaactcgccgaccgc
tacggcccccgcttcaccccaccgcgactgctcctggagaaggcggagaagggggagcgc
ttctccgacgggtga

DBGET integrated database retrieval system