KEGG   Streptomyces scabiei: SCAB_13351Help
Entry
SCAB_13351        CDS       T01187                                 

Gene name
fadB1
Definition
fatty acid oxidative multifunctional protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scb  Streptomyces scabiei
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_13351 (fadB1)
   01212 Fatty acid metabolism
    SCAB_13351 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAB_13351 (fadB1)
   00650 Butanoate metabolism
    SCAB_13351 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    SCAB_13351 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    SCAB_13351 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAB_13351 (fadB1)
   00310 Lysine degradation
    SCAB_13351 (fadB1)
   00380 Tryptophan metabolism
    SCAB_13351 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_13351 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAB_13351 (fadB1)
   00281 Geraniol degradation
    SCAB_13351 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SCAB_13351 (fadB1)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCAB_13351 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAB_13351 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCAB_13351 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1494552..1496726)
Genome map
AA seq 724 aa AA seqDB search
MTESTTIRWEQDRTGLVTLVIDDPNQSANTMNQAFRDSLAVITDRLEAEKDTIRGVIITS
AKKTFFAGGDLRDLIRVTPDTARQLFDGGLEIKRNLRRIETLGKPVVAAINGAALGGGYE
LALACHHRVALDAPGSKIGCPEVTLGLLPGGGGVVRTVRLLGIADALLKVLLQGTQYSPR
AALENGLIHEVASTRDELLDKARAFIDANPESQQPWDRPGHRIPGGTPSHPKFAANLPAF
PATLRKQTGGAPYPAPRAILAAAVEGAQVDFETAQVIEARYFVELAAGRTSKNMIQAFFF
DLQAVNSGANRPQGIEPRQVRKVAVLGAGMMGAGIAYSCARAGIDVVLKDVTPEAAAKGK
EYSEKLCARAVAKGRTTQDKADALLARITPTADPADLAGCDAVIEAVFENTELKHKVFQE
IEGVVAPDALLCSNTSTLPITELAEGVVRRSDFIGLHFFSPVDRMPLVEIIKGEQTGDEA
LARAFDLVRQIRKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRAESRRAVEEAGGTWVEHPADAVIDRMVDEFARPGRSGGAGF
YDYGPDGRRGKLWPGLREHFTRPGHRIPFEDMRERMLFAEALDTVRLLEEGVLTSVADAN
IGSLLGIGFPGWTGGVLQYINGYEGGLPGFVTRARELADRYGPRFTPPRLLLEKAEKGER
FSDG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaccaccatccgctgggaacaggaccgcacgggcctggtcaccctcgtc
atcgacgacccgaaccagtccgcgaacaccatgaaccaggcgttccgcgactccctcgcg
gtgatcaccgaccgcctggaggcggagaaggacaccattcgcggtgtcatcatcacctcc
gccaagaagaccttcttcgccggcggcgacctccgtgacctcatccgggtcacccccgac
accgcccggcagctgttcgacggcggcctggagatcaagcgcaacctgcgccgcatcgag
acgctcggcaagcccgtcgtcgcggcgatcaacggcgcggccctgggcggcggctacgaa
ctggccctggcctgccaccaccgcgtcgccctggacgcccccggctcgaagatcggctgc
cccgaggtcaccctcggcctgctgcccggcggcggcggtgtcgtgcgcaccgtccgtctg
ctgggcatcgccgacgccctgctgaaggtgctgctgcagggcacccagtacagcccgcga
gccgccctggagaacggcctgatccacgaagtggcctccacccgggacgagttgctggac
aaggcccgcgccttcatcgacgccaaccccgagtcgcaacagccctgggaccggcccggc
caccgcatccccggcggcaccccctcccacccgaagttcgcggcgaacctgcccgccttc
cccgccaccctgcgcaagcagacgggcggcgcgccctacccggccccgcgcgccatcctc
gccgccgccgtcgagggcgcccaggtcgacttcgagaccgcccaggtcatcgaggcgcgc
tacttcgtggagctggcggcgggccggacgtccaagaacatgatccaggccttcttcttc
gacctccaggccgtcaactccggcgcgaaccgcccccaaggcatcgagccccgccaggtc
cgcaaggtggccgtcctcggcgccgggatgatgggtgcgggcatcgcctactcgtgcgcc
cgcgcgggcatcgacgtcgtcctgaaggacgtgacgcccgaagcggcggcgaagggcaag
gagtactcggagaagctctgcgcccgagcggtcgccaagggccgcaccacgcaggacaag
gccgacgccctcctcgcccgcatcacccccaccgccgacccggccgacctcgcgggctgc
gacgcggtcatcgaggccgtgttcgagaacaccgagctgaagcacaaggtgttccaggag
atcgagggggtggtggcgccggacgccctgctctgctccaacacctccaccctccccatc
accgagctggccgagggcgtcgtgcgccggtccgacttcatcggcctgcacttcttctca
cccgtcgacaggatgccgctcgtcgagatcatcaagggcgagcagacgggagacgaggcc
ctggcccgcgccttcgacctcgtccgccagatccgcaagacaccgatcgtcgtcaacgac
tcgcgcggcttcttcacctcccgggtcatcgggcacttcatcaacgagggcgtcgcgatg
gtgggggagggcatcgagcccgcctcggtcgaacaggcggcggcccaggcgggctacccc
gccaaggtcctctccctcatggacgagctgaccctcaccctgccccgcaagatccgcgcc
gagtcccggcgggccgtggaggaggcgggcggcacctgggtggagcacccggccgacgcg
gtcatcgaccggatggtcgacgagttcgcccgccccggccgcagcggaggcgccgggttc
tacgactacggtcccgacggccgccgcggcaagctctggcccgggctgcgcgagcacttc
acccggcccgggcaccggatcccgttcgaggacatgcgggaacgcatgctcttcgcggag
gccctggacacggtccgcctcctcgaagagggcgtcctgacctccgtcgccgacgccaac
atcggctccctcctcggcatcggcttccccggctggaccggcggcgtcctgcagtacatc
aacggctacgagggcggcctccccggcttcgtgacccgggcccgggaactcgccgaccgc
tacggcccccgcttcaccccaccgcgactgctcctggagaaggcggagaagggggagcgc
ttctccgacgggtga

DBGET integrated database retrieval system