KEGG   Streptomyces scabiei: SCAB_16431Help
Entry
SCAB_16431        CDS       T01187                                 

Definition
cellulase CelA1 (ENDOGLUCANASE) (ENDO-1,4-BETA-GLUCANASE) (FI-CMCASE) (CARBOXYMETHYL CELLULASE)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
scb  Streptomyces scabiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1846077..1847042
Genome map
AA seq 321 aa AA seqDB search
MRRRLRALMAALCSLPLALAAAPSAHAADPTGMTSGFYVDPDNSAKRWAAANPGDGRASA
INASIANTPMARWFGSWSGSIGSATGSFTGAADSRDKLPILVAYNVYNRDYCGGHSAGGA
SSPSAYASWISQFAGGIGNRPALVILEPDSLGDYGCMNQAQIAERQSMLSGAVSQFSRQA
PNTWVYMDAGNPAWTDAATMAKRLHEAGVRQAHGFSLNISNYLTTGENTAYGNAVNRELS
ARYGYTKPFVVDTSRNGNGSNGQWCNPSGRRIGPATQMGGGAEMLLWIKVPGESDGNCGV
GSGSSAGQFLPEVAYKMIYGY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaggctccgcgccctgatggcagcgctctgctcgttgccgctcgcgctcgcc
gccgctccgtccgcccacgccgccgacccgaccggcatgaccagcgggttctatgtggac
cccgacaacagcgcgaagcggtgggccgccgccaaccccggtgacggccgggcgtccgcg
atcaacgcctccatcgccaacaccccgatggcccgctggttcggctcgtggagcggctcg
atcgggtccgccacgggctcgttcacgggcgccgcggacagccgggacaagctacctatt
ctggtcgcgtacaacgtctacaaccgcgactactgcggcgggcactccgcgggcggagcc
tcctcgccgtccgcctacgcgagctggatctcccagttcgccggcggcatcggcaaccgt
ccggcgctggtgatcctggagccggactccctcggggactacggctgcatgaaccaggcg
cagatagccgagcgccagagcatgctcagcggcgccgtctcccagttcagccgccaggcc
cccaacacctgggtctacatggacgccggcaaccccgcctggacggacgccgcgaccatg
gccaagcggctgcacgaggcgggcgtgcggcaggcccacggcttctcgctgaacatctcc
aactacctcaccacgggcgagaacaccgcctacggcaacgcggtgaacagggagctcagt
gcccgctacggctacaccaagccgttcgtcgtggacaccagccgcaacggcaacggctcc
aacggccagtggtgcaacccctcgggccgccgcatcggccccgccacccagatgggcggc
ggcgcggagatgctgctgtggatcaaggtgccgggcgagtcggacggcaactgcggtgtg
ggatccggctcctcggccggtcagttcctgcccgaggtcgcctacaagatgatctacggc
tactga

DBGET integrated database retrieval system