KEGG   Streptomyces scabiei: SCAB_16581Help
Entry
SCAB_16581        CDS       T01187                                 

Definition
succinyl-coa synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
scb  Streptomyces scabiei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_16581
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAB_16581
   00640 Propanoate metabolism
    SCAB_16581
   00660 C5-Branched dibasic acid metabolism
    SCAB_16581
Enzymes [BR:scb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCAB_16581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1864602..1865732)
Genome map
AA seq 376 aa AA seqDB search
MDLFEHQARALFEEHGIAVPRAEVTDSPKEAREIARRLGGRVVVKAQVKTGGRGKAGGVK
LAADPAAAELTARQILGTDIKGHTVRTVMIAEPVAIESEFYVSYVLDRAAGGFLAIASAE
GGMDIEEVAATRPEAVARIPVDPAEGVTSAKASEIAEAAGLPPQSVDVLMRLWQVLTRED
ALLVEVNPLVRTAQGRILALDGKVTLDDNAGFRQSRWGDEGFAHDDPLEAAAAAKGLNYV
KLEGEVGVIGNGAGLVMSTLDVVAGCGARPANFLDIGGGASARIMADGLSVILSDPAVKS
VLVNVFGGITACDAVAEGIVRALDSVRLTKPLVVRLDGNNAVRGRAILDTRAHPLVHQAT
TMDGAARRAADLAHAN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaccttttcgagcaccaggcacgagcactcttcgaggaacacggcatcgcggtcccg
cgggccgaggtcaccgactcgcccaaggaggcccgcgagatcgcccgcaggctgggcgga
cgcgtcgtcgtcaaggcacaggtgaagaccggcggacgcggcaaggcgggcggggtgaag
ctcgccgccgaccccgccgccgccgaactgaccgcacggcagatcctcggcacggacatc
aagggccacaccgtccgcacggtgatgatcgccgaacccgtcgcgatcgagagcgagttc
tacgtctcctacgtcctcgaccgcgcggccggcggcttcctcgcgatcgcctcggccgag
ggcggcatggacatcgaggaggtggcggccacccggcccgaggcggtggcccgcatcccg
gtcgaccccgccgagggcgtcacctccgccaaggcgtccgagatcgccgaggcggccggt
ctgcccccgcagagcgtcgacgtcctcatgcggctctggcaggtgctgacccgcgaggac
gcgctcctcgtcgaggtcaacccgctcgtgcgtaccgcacagggccgcatcctcgccctc
gacggcaaggtcaccctcgacgacaacgcgggtttccggcagagccgctggggcgacgag
ggcttcgcgcacgacgacccgctggaggcggcggcggccgccaagggcctcaactacgtg
aagctggaaggcgaggtcggggtcatcggcaacggcgccggactcgtcatgtcgaccctc
gacgtggtcgccggatgcggtgcccgtcccgccaacttcctcgacatcggcggcggcgcc
tccgcccggatcatggccgacggtctctccgtcatcctctccgacccggccgtgaagtcc
gtcctcgtcaacgtcttcggcgggatcaccgcctgcgacgcggtcgccgagggcatcgtg
agggccctggacagcgtgcggttgaccaagccgctggtcgtccgtctcgacggcaacaac
gccgtacgcggccgggcgatcctcgacacccgcgcccacccactcgtccaccaggccacc
accatggacggtgccgcgcgccgcgccgccgacctcgcccacgcgaactga

DBGET integrated database retrieval system