KEGG   Streptomyces scabiei: SCAB_18211Help
Entry
SCAB_18211        CDS       T01187                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:scb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scb00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scb00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:scb00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2054213..2055358)
Genome map
AA seq 381 aa AA seqDB search
MSTYRDFTHRGSARATVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNILE
KLRTETPDKSKSPQVVEDTITELVLDLSDRHDVHAVGIGAAGWVDADRNRVLFAPHLSWR
NEPLRDRLAGRLAVPVLVDNDANAAAWAEWRFGAGRDEDHLVMITLGTGIGGAILEDGQV
KRGKFGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAYGIIE
HVKGNIGDITGPMITELAREGDAMCIELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFRRHLTGRGYRPEARIARAQLGPEAGMVGAADLARLVARRFRRANRRR
VERYERYARYVEARRTTQDTA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttaccgcgacttcacccaccgcggctccgcgcgggccaccgtcctgcggacc
gtgggaacgcgcgagcgccgctcccacctgacggccccccgcgtccccaccgtcggtatc
gacatcggcggcacgaaggtgatggcgggcgtcgtggacgccgacggcaacatcctggag
aagctccgcacggagaccccggacaagtccaagagcccccaggtcgtcgaggacaccatc
acggaactggtcctggacctctccgaccggcacgacgtgcacgccgtcggcatcggcgcc
gccggctgggtggacgcggaccgcaaccgtgtcctgttcgccccccacctgtcctggcgc
aacgagcccctgcgcgaccgcctcgccggccgcctggccgtacccgtcctcgtcgacaac
gacgccaacgccgccgcctgggcggagtggcggttcggcgccggccgcgacgaggaccac
ctggtcatgatcaccctcggtaccggtatcggcggcgcgatcctggaggacggccaggtc
aagcgcggcaagttcggggtcgcgggcgagttcggtcatatgcaggtcgtgcccggcggc
caccgctgcccgtgcggcaaccgcggctgctgggagcagtacagctcggggaacgccctg
gtcagggaggcccgcgaactcgcggcggccgactccccggtggcgtacgggatcatcgag
cacgtcaaggggaacatcggggacatcaccggcccgatgatcaccgagctggcccgtgag
ggcgacgcgatgtgcatcgagctgctccaggacatcggccagtggctcggcgtcggcatc
gccaacctcgccgccgccctcgacccctcctgcttcgtcatcggcggcggtgtctcggcc
gccgacgacctgctgatcggccccgcccgggacgccttccgccgccacctcaccggccgc
ggctaccgccccgaggcccggatcgcccgcgcccagctcgggcccgaggccggcatggtg
ggcgccgcagacctcgccagactcgtcgcccgccgcttccgccgcgccaaccggcgccgg
gtggaacggtacgagcgctatgcgaggtacgtggaggcccgccgcaccacccaggacacc
gcgtga

DBGET integrated database retrieval system