KEGG   Streptomyces scabiei: SCAB_18361Help
Entry
SCAB_18361        CDS       T01187                                 

Gene name
aceB1
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
scb  Streptomyces scabiei
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_18361 (aceB1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCAB_18361 (aceB1)
   00630 Glyoxylate and dicarboxylate metabolism
    SCAB_18361 (aceB1)
Enzymes [BR:scb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCAB_18361 (aceB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068550..2070184
Genome map
AA seq 544 aa AA seqDB search
MSAPAPSPLAIVDAEPLPRQDEILDPAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWRVAPSPAALDDRRVEITGPTDRKMTINALNSGARVWLADFED
ASAPTWENVVLGQVNMADAYTRSIDFTDERTGKSYGLRPNEELATVVMRPRGWHLDERHL
VDADGTPVPGALVDFGLYFFHNAQRLLDLGKGPYFYLPKTESHLEARLWNEVFVFAQEYC
GIPQGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGARFVL
PDRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDEEVNKVAFEKVKADKD
REANDGFDGSWVAHPDLVPIAMASFDAVLGDRPNQKDRLREDVDVKAADLIAVDSLDARP
TYAGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVEFEHDGS
TVRATPELARKVAADELAAVRAEIGEAAFAAGHWQQAHDLLLQVALDEDYADFLTLPAYE
QLKG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccatcgtcgacgccgagcctctgccccgccag
gacgagatcctcgacccggccgccctcgccttcgtggccgaactgcaccgccggttcacg
ccccggcgtgacgaactgctggcccgccgcgccgagcggcgcgccgagatcgcccgcacc
tccacgctcgacttcctcccggagaccgccgcgatccgcgccgacgactcgtggcgggtg
gccccctcccccgccgcgctggacgaccggcgcgtcgagatcaccggccccaccgaccgc
aagatgacgatcaacgccctgaactcgggcgcacgggtctggctcgcggacttcgaggac
gcctccgcgccgacctgggagaacgtggtcctcggccaggtgaacatggccgacgcctac
acccgcagcatcgacttcaccgacgagcgcaccggcaagtcgtacggcctgcgcccgaac
gaggagctggcgacggtcgtcatgcgcccgcgcggctggcacctcgacgagcgccacctc
gtcgacgccgacggcacccccgtccccggcgcgctcgtcgacttcggcctgtacttcttc
cacaacgcgcagcggttgctggacctcggcaagggcccgtacttctacctcccgaagacc
gagtcgcacctcgaagcccgcctgtggaacgaggtgttcgtgttcgcgcaggagtactgc
ggcatcccgcagggcacggtccgcgcgaccgtcctgatcgagacgatcacggccgcgtac
gagatggaggagatcctctacgaactccgcgaccacgcctccgggttgaacgcgggccgc
tgggactacctgttctccatcgtgaagaacttccgtgacggcggcgccaggttcgtcctc
ccggaccgcaacgcggtcacgatgacggccccgttcatgcgggcgtacaccgaactcctc
gtccgcacctgccacaagcgcggcgcgcacgcgatcggcggcatggccgcgttcatcccg
tcgcggcgcgacgaggaggtcaacaaggtcgcgttcgagaaggtcaaggccgacaaggac
cgcgaggcgaacgacggcttcgacggctcctgggtggcccacccggacctggtcccgatc
gccatggcctccttcgacgccgtcctcggcgaccggccgaaccagaaggaccgcctgcgc
gaggacgtcgacgtgaaggccgccgacctgatcgccgtcgactccctcgacgcccggcct
acctacgccggtctcgtcaacgccgtccaggtcggcatccggtacatcgaggcgtggctg
cggggcctcggtgccgtcgccatcttcaacctgatggaggacgcggccaccgcggagatc
tcccgctcccagatctggcagtggatcaacgcgggcgtcgagttcgagcacgacgggagc
acggtgcgggccacacccgaactggcccgcaaggtcgcggccgacgaactggccgccgtc
cgggccgagatcggcgaggcggcgttcgcggccggccactggcagcaggcccacgacctg
ctcctccaggtcgccctcgacgaggactacgcggacttcctgacgctcccggcgtacgag
cagctcaagggctga

DBGET integrated database retrieval system