KEGG   Streptomyces scabiei: SCAB_18361Help
Entry
SCAB_18361        CDS       T01187                                 

Gene name
aceB1
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
scb  Streptomyces scabiei
Pathway
scb00620  Pyruvate metabolism
scb00630  Glyoxylate and dicarboxylate metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCAB_18361 (aceB1)
   00630 Glyoxylate and dicarboxylate metabolism
    SCAB_18361 (aceB1)
Enzymes [BR:scb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCAB_18361 (aceB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CBG68963
UniProt: C9ZGJ3
Position
2068550..2070184
Genome map
AA seq 544 aa AA seqDB search
MSAPAPSPLAIVDAEPLPRQDEILDPAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWRVAPSPAALDDRRVEITGPTDRKMTINALNSGARVWLADFED
ASAPTWENVVLGQVNMADAYTRSIDFTDERTGKSYGLRPNEELATVVMRPRGWHLDERHL
VDADGTPVPGALVDFGLYFFHNAQRLLDLGKGPYFYLPKTESHLEARLWNEVFVFAQEYC
GIPQGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGARFVL
PDRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDEEVNKVAFEKVKADKD
REANDGFDGSWVAHPDLVPIAMASFDAVLGDRPNQKDRLREDVDVKAADLIAVDSLDARP
TYAGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVEFEHDGS
TVRATPELARKVAADELAAVRAEIGEAAFAAGHWQQAHDLLLQVALDEDYADFLTLPAYE
QLKG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccatcgtcgacgccgagcctctgccccgccag
gacgagatcctcgacccggccgccctcgccttcgtggccgaactgcaccgccggttcacg
ccccggcgtgacgaactgctggcccgccgcgccgagcggcgcgccgagatcgcccgcacc
tccacgctcgacttcctcccggagaccgccgcgatccgcgccgacgactcgtggcgggtg
gccccctcccccgccgcgctggacgaccggcgcgtcgagatcaccggccccaccgaccgc
aagatgacgatcaacgccctgaactcgggcgcacgggtctggctcgcggacttcgaggac
gcctccgcgccgacctgggagaacgtggtcctcggccaggtgaacatggccgacgcctac
acccgcagcatcgacttcaccgacgagcgcaccggcaagtcgtacggcctgcgcccgaac
gaggagctggcgacggtcgtcatgcgcccgcgcggctggcacctcgacgagcgccacctc
gtcgacgccgacggcacccccgtccccggcgcgctcgtcgacttcggcctgtacttcttc
cacaacgcgcagcggttgctggacctcggcaagggcccgtacttctacctcccgaagacc
gagtcgcacctcgaagcccgcctgtggaacgaggtgttcgtgttcgcgcaggagtactgc
ggcatcccgcagggcacggtccgcgcgaccgtcctgatcgagacgatcacggccgcgtac
gagatggaggagatcctctacgaactccgcgaccacgcctccgggttgaacgcgggccgc
tgggactacctgttctccatcgtgaagaacttccgtgacggcggcgccaggttcgtcctc
ccggaccgcaacgcggtcacgatgacggccccgttcatgcgggcgtacaccgaactcctc
gtccgcacctgccacaagcgcggcgcgcacgcgatcggcggcatggccgcgttcatcccg
tcgcggcgcgacgaggaggtcaacaaggtcgcgttcgagaaggtcaaggccgacaaggac
cgcgaggcgaacgacggcttcgacggctcctgggtggcccacccggacctggtcccgatc
gccatggcctccttcgacgccgtcctcggcgaccggccgaaccagaaggaccgcctgcgc
gaggacgtcgacgtgaaggccgccgacctgatcgccgtcgactccctcgacgcccggcct
acctacgccggtctcgtcaacgccgtccaggtcggcatccggtacatcgaggcgtggctg
cggggcctcggtgccgtcgccatcttcaacctgatggaggacgcggccaccgcggagatc
tcccgctcccagatctggcagtggatcaacgcgggcgtcgagttcgagcacgacgggagc
acggtgcgggccacacccgaactggcccgcaaggtcgcggccgacgaactggccgccgtc
cgggccgagatcggcgaggcggcgttcgcggccggccactggcagcaggcccacgacctg
ctcctccaggtcgccctcgacgaggactacgcggacttcctgacgctcccggcgtacgag
cagctcaagggctga

DBGET integrated database retrieval system