KEGG   Streptomyces scabiei: SCAB_18521Help
Entry
SCAB_18521        CDS       T01187                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
scb  Streptomyces scabiei
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCAB_18521
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SCAB_18521
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SCAB_18521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2086356..2087261)
Genome map
AA seq 301 aa AA seqDB search
MPTILGQNQYGKAENRVVKITRDGATHHIKDLNVSVSLSGDMTEVHLSGSNANVLPTDTT
KNTVYAFAKEHGIESAEQFGIHLARHFVTSQPAIHRARIRVEEYAWERIEHGGEGAHSFV
RRGQETRLAQITYDGSSWEVVSGLKDLTVMNSTDSEFWGYVKDAYTTLPEAHDRILATEV
SGRWRFNWTDDAQEMPDWDTSYEQTKQHLLRAFAETYSLSLQQTLYQMGSRIIEHRDEID
EVRFSLPNKHHFLVDLKPFGLDNATEDGAVYVAADRPYGLIEATVLRDGREARIPTDLTN
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatcctgggacagaaccagtacggcaaggccgagaaccgggtcgtcaagatc
acacgggacggtgccacccaccacatcaaggacctgaacgtgtccgtgtcgctctccggc
gacatgaccgaggtccatctgtcgggatcgaacgcgaacgtcctgccgaccgacaccacc
aagaacacggtgtacgcgttcgccaaggagcacggcatcgagtccgccgagcagttcggc
atccacctggcccggcacttcgtgacctcccagcccgccatccaccgggcccgcatacgc
gtcgaggagtacgcctgggagcgcatcgagcacggcggcgagggcgcgcactccttcgtc
cgcaggggacaggagacccggctcgcgcagatcacctacgacggctcgtcctgggaggtc
gtctccggcctcaaggacctcaccgtcatgaactcgaccgactccgagttctggggctac
gtcaaggacgcctacacgaccctgcccgaggcgcacgaccgcatcctcgccaccgaggtc
tccggccgctggcgcttcaactggaccgacgacgcccaggagatgcccgactgggacacc
tcgtacgagcagacgaagcagcacctgctccgggccttcgccgagacctactcgctctcg
ctccagcagaccctgtaccagatgggctcgcggatcatcgagcaccgcgacgagatcgac
gaggtccgcttctcgctgcccaacaagcaccacttcctggtggacctgaagcccttcggc
ctggacaacgccaccgaggacggtgccgtgtacgtcgccgccgaccggccctacggcctg
atcgaggcgaccgtcctgcgggacggacgcgaggcgcggatccccacggacctgaccaac
ctctga

DBGET integrated database retrieval system