KEGG   Streptomyces scabiei: SCAB_18811Help
Entry
SCAB_18811        CDS       T01187                                 

Definition
LacI family transcriptional regulator
Orthology
K02529  
LacI family transcriptional regulator
Organism
scb  Streptomyces scabiei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2120338..2121453
Genome map
AA seq 371 aa AA seqDB search
MTSAGNSSSDSGQARRSRRGPNGTQGGDRPSTIRDVATRAGVSVATVSRTLAGNYPVSAT
TRARVMAAVESLHYVVNVHAKALSGRVAGPIALVIQDITGPSLAHVAAGVEQEAADRGRL
SLVCATHGDAAREDDLVQLMREQHAGAVVLVGGAVQDDAYRSRMAGYAKALDAAGSRLVL
VGRPSLPDGLPVTVIEYDNRGGAFQAVDHLLTAGHRRILFLGGDPLLSTAERRREGWLHA
LRAHGVPPAEELDLPGPYTRVSGYQRIREALAAGLDFTAVFAGTDVVATGALAALREAGL
DVPGDVSLVGFDDVPFAADLSPALTTVRVPYEDLGRTAVRLALGRGERLTADDHVVLGTQ
LVIRRSVRRLG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcgcgggaaacagttcctcggacagcggacaggccagacggtccaggcgtggg
ccgaacggcacacagggcggcgaccgccccagcaccattcgcgatgtggccacccgggcc
ggcgtctcggtagcaaccgtttcccgcaccctcgccggcaactacccggtgtccgccacc
acacgtgcacgcgtcatggccgccgtggagtcactgcactacgtggtgaacgtgcacgcc
aaagcgctctcagggcgggtggccggccccatcgccctggtcatccaggacatcaccggc
ccgtcgctggcccatgtggcggccggagtggagcaggaggcggcggaccgcggcaggctg
agcctcgtctgcgccacgcacggggacgcggcccgcgaggacgacctcgtgcagctgatg
cgcgaacagcacgcgggcgcggtggtgctggtgggcggcgcggtgcaggacgacgcgtac
cgctcccgcatggccgggtacgccaaggccctggacgccgcagggtcccgcctggtgctc
gtcggccggccgtcgctgcccgacggtcttcccgtcacagtgatcgagtacgacaaccgt
gggggcgccttccaggccgtggaccatctcctcaccgccgggcaccgacgcattctcttc
ctcggcggcgacccgctgctgagcacggccgaacgacgtcgcgaagggtggttgcacgcg
ctgcgagcccacggagtgccgcccgccgaggaactcgacctgcccggcccctacacccgg
gtttcgggctaccagagaatccgggaggcgctcgccgccggactggacttcaccgcggtc
ttcgcgggtacggacgtggtggcgaccggcgcgctggccgcgctgcgggaggcgggtctg
gacgtcccgggtgacgtgtccctcgtgggcttcgacgacgtccccttcgccgccgatctc
agtcccgccctcaccaccgttcgggttccttacgaggacctgggacgcacggcggttcga
ctggcactgggccgcggagagcgcctgacggccgatgaccacgtcgtgctcggcacacag
ctggtgatacggcggtcggtacgccggctgggatga

DBGET integrated database retrieval system