KEGG   Streptomyces scabiei: SCAB_20021Help
Entry
SCAB_20021        CDS       T01187                                 

Definition
alpha-amylase
Orthology
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
scb  Streptomyces scabiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCAB_20021
Enzymes [BR:scb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     SCAB_20021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2270754..2273096
Genome map
AA seq 780 aa AA seqDB search
MTSVVPAATYRIQLQPGFPFAAASAAVPYIASLGISHLHLSPVLEAVPGSAHGYDVVDHG
RVREELGGEEGLRALARTARDHGLGLVADIVPNHMAMAPRHNRALWEVLRDGPESAYARW
FDIDWEAQGGRVLLPVLGGPLGEEVARFVVEGRELRYFDHRFPLREGTEKLPLPQLLDAQ
WYRPVWWRLARTELNYRRFFSISELIGVRVEDPDVFDATHATILRLLEEGVLDGLRVDHP
DGLADPGAYLRRLHGATGGRWTVVEKILADGEPLPADWPVAGTTGYDALRHVDGLFTDPA
GGGELLGAYRRFTGAQADRGGEWEATVRRAAYRVLTHELVAEVERLTRVAHRLCERSPDL
ALRDQAPWALRTALCELLARMEVYRPYPSQDASLVVTEEAAAEARALFVVPEEARSVDAV
RDLVLGRAGEGPGHAEFRARFAQTSSALRAKSVEDTAFYRYVPLLSANEVGGDPGSPAVS
VRDFHAYCARVQRDWPATGTVLSTHDTKRSADVRAAVAVLAECPERWAGVLAEVTRDEPG
APDQQLAWAAWQTAFGLGPADPDRLREALLKHVREAGLQTSWTEQDPEYERAVADFVARG
PAVDARVAALREELEPYVRANSLGAALVQLTMPGVPDLYQGTEGEYRALVDPDNRRPFAP
RDEEPDGTGTDKFRLTSAALRLRARRPEVFGDAATYVPLPADGPRAGHCVAFSRSGEVVT
AVTRLSLRLAEAGGWGDTLLTLPEGRWAEVAGSGREFTGDVRVADLFATLPVALLERVGV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtcgtgcctgccgccacctaccgcatccagctccagcccggcttcccgttc
gccgccgcctcggccgccgtgccgtacatcgcctccctgggcatctcccatctgcacctc
tcccccgtgctggaggccgtgcccgggtccgcgcacgggtacgacgtggtcgaccacggg
cgggtgcgggaggaactcgggggtgaggaggggctgcgggcgctggcccggaccgcccgg
gaccacgggctcggcctcgtcgcggacatcgtgccgaaccacatggccatggccccccgg
cacaaccgggcgctgtgggaggtgctgcgggacggcccggagtcggcgtacgcgcggtgg
ttcgacatcgactgggaggcgcagggcggccgggtgctgctgccggtgctcggcgggccg
ctcggcgaggaggtcgcgcggttcgtggtggaggggcgcgagctgcgctacttcgaccac
aggttcccgctgcgcgagggcaccgagaagctgccgctgccgcagctgctggacgcgcag
tggtaccggccggtgtggtggcggctggcccggacggagctgaactaccggcggttcttc
agcatctcggagctgatcggggtgcgggtcgaggacccggacgtcttcgacgcgacccat
gcgacgatccttcggctgctggaggagggggtcctcgacgggctgcgcgtcgaccatccc
gacgggctcgccgatccgggcgcctatctgcggcggctgcacggggcgacgggcgggcgg
tggaccgtcgtcgagaagatcctggcggacggggagccgctgccggcggactggccggtg
gcggggaccaccggttacgacgcgctgcggcacgtcgacgggctgttcacggacccggcg
ggtggcggtgaactgctgggcgcgtaccggcggttcaccggcgcccaggcggaccggggc
ggcgagtgggaggcgaccgtccgccgggccgcctaccgggtgctcacgcacgagctggtc
gccgaggtggaacggctcacccgggtggcgcaccggctctgcgaacgctcccccgacctc
gcgctgcgcgaccaggcgccgtgggcgctgcgcacagcgctgtgcgagctgctcgcgcgc
atggaggtgtaccggccctacccctcccaggacgcctcgctcgtcgtcaccgaggaggcc
gcggccgaggcacgcgcgctgttcgtggtgcccgaggaggcccgctcggtggacgccgta
cgggatctggtgctgggcagggccggcgagggacccggacacgcggagttccgggcgcgg
ttcgcgcagacctcgtcggcgctgcgggcgaagtcggtggaggacacggcgttctaccgc
tatgtcccgctgctgtcggcgaacgaggtgggcggcgatcccggaagcccggccgtgtcg
gtgcgggacttccacgcctactgcgcccgggtgcagcgcgactggcccgccacggggacc
gtgctgtcgacgcacgacaccaagcgcagcgccgatgtgcgggcggccgtcgcggtgctc
gccgagtgccccgagcggtgggccggcgtgctggcggaggtgacccgggacgagcccggc
gcaccggatcagcagctggcgtgggcggcctggcagacggcgttcggtctcgggccggcg
gacccggaccggctgcgggaggccctgctgaagcatgtgcgggaggccggcctgcagacc
tcctggaccgagcaggacccggagtacgaacgggcggtggcggacttcgtcgcccggggc
cccgccgtggacgcgcgggtcgccgcgctgcgcgaggagctggagccgtacgtacgggcc
aacagcctcggcgcggccctggtgcagctcaccatgccgggggtgccggacctctaccag
ggcacggagggcgagtaccgggcgctggtggacccggacaaccgcaggcccttcgcgccg
cgggacgaggagcccgacgggaccggcaccgacaagttccggctcacctcggccgcgctg
cggctgcgggcgcggcggccggaggtgttcggggacgcggcgacgtacgtgccgctgccg
gcggacgggccgcgggccgggcactgtgtggccttctcgcggtccggggaggtggtcacg
gcggtgacgcgtctgtcgctgcggctggcggaggccgggggctggggcgacaccctgctg
acgctgccggagggccggtgggccgaggtggcgggctcggggcgggagttcaccggcgac
gtacgggtggcggacctcttcgcgaccctgccggtcgcgctgctggagcgtgtcggcgtc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system