KEGG   Streptomyces scabiei: SCAB_20811Help
Entry
SCAB_20811        CDS       T01187                                 

Definition
(GenBank) putative oxidoreductase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
scb  Streptomyces scabiei
Pathway
scb00860  Porphyrin and chlorophyll metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAB_20811
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SCAB_20811
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SCAB_20811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 HI0933_like Pyr_redox AlaDh_PNT_C FAD_binding_3 FAD_oxidored Lycopene_cycl NAD_binding_9 Thi4 GIDA Pyr_redox_3 NAD_binding_7 MCRA 3HCDH_N FMO-like
Motif
Other DBs
NCBI-ProteinID: CBG69196
UniProt: C9YVV7
Position
complement(2354298..2355782)
Genome map
AA seq 494 aa AA seqDB search
MSGSGTDAGRGAGHVVVIGAGIAGLAAAHRLVDRGARVTVLEAADRVGGKLLPGEIAGAR
VDLGAESMLARRPEAVALAREVGLADRLRPPATATASLWTRGALRPMPKGHVMGVPGTAS
ALAGVLSDEGLARIERDADLPRTEVGDDVAVGEYVAARLGREVVDRLVEPLLGGVYAGDA
YRISMRSAVPQLFQAALTHTSLTEAVRGIQERAAAAGQTGPVFMGIEGGIGRLPLAVAES
VRARGAEIRTRTSVTGLRREAPGGWRVVTGGTGGGEERVLRADAVVLAVPAPVAAALLRA
EAPGAAAELAGVEYASMALVTLAYRRAGLTLPEGSGFLVPPVDGRTIKASTFSSRKWGWL
AEENPDLLILRTSVGRYGETAILDHDDAHLVDVSRTDLREATGLTAAPVETRVTRWDDGL
PQYPVGHHARVTRVREYLSKLPGLAVCGAAYDGVGIPACVASATAAVDEIHGDLRALRDL
TADPVQSLHGGAGE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcaggtacggacgccgggcgcggcgccgggcacgtcgtcgtcatcggggcc
ggcatcgcggggctcgccgccgcgcacaggctggtggaccggggcgcgcgagtgaccgtc
ctggaggccgcggaccgcgtcggcggcaagctgctgcccggcgagatcgcgggcgcgcgc
gtcgacctcggcgccgagtcgatgctcgcccgccgccccgaggcggtcgccctcgcgcgc
gaggtgggtctcgccgaccggctccggccgccggccaccgccacggcctccctgtggacc
cggggcgccctgaggcccatgcccaagggccatgtcatgggggtccccggcaccgcgtcc
gcgctcgcgggggtcctgtccgacgagggcctggcccggatcgagcgcgacgccgacctg
ccgcgcaccgaggtcggcgacgacgtggcggtgggggagtacgtggcggcccgcctcggc
cgcgaggtcgtcgaccgtctggtggaacccctgctcggcggtgtctacgcgggcgacgcg
taccgcatctcgatgcgttcggccgtgccgcagctcttccaggcggcgctgacccacacc
tccctcaccgaggccgtccggggcatccaggagcgcgcggcggccgccgggcagaccggg
ccggtgttcatgggcatcgagggcgggatcggccggctgccgctcgcggtggccgagtcg
gtgcgggcccgcggcgccgagatccgtacccgcacgtccgtcaccggactgcgccgggag
gctcccggcggctggcgtgtcgtcaccggcggtacgggcggcggggaggagcgtgtcctg
cgcgccgacgccgtggtcctggccgtccccgccccggtcgccgccgccctcctgcgcgcc
gaggcccccggcgccgcggccgagctggcgggtgtggagtacgcctcgatggccctggtc
accctcgcctaccgccgggccggactcaccctgcccgagggcagcggcttcctggtgccg
ccggtcgacggccgcacgatcaaggcgtcgacgttctcctcccgcaagtggggctggctc
gccgaggagaacccggacctgctgatcctgcgcacctcggtcggccggtacggcgagacg
gcgatcctggaccacgacgacgcccacctcgtggacgtgtcgcggaccgacctgcgcgag
gccaccggcctgaccgccgccccggtcgagacccgcgtcacccgctgggacgacggcctg
ccccagtacccggtcggccaccacgcgcgcgtgacccgcgtccgcgagtacctgagcaag
ctgccgggcctcgcggtctgcggagcggcgtacgacggtgtcggcatccccgcctgcgtc
gcgagcgccaccgcggccgtcgacgagatccacggcgacctgcgcgcgctgcgggatctc
accgccgacccggtgcagagcctccacggcggagcgggagaatag

DBGET integrated database retrieval system