KEGG   Streptomyces scabiei: SCAB_20811Help
Entry
SCAB_20811        CDS       T01187                                 

Definition
oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
scb  Streptomyces scabiei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAB_20811
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SCAB_20811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2354298..2355782)
Genome map
AA seq 494 aa AA seqDB search
MSGSGTDAGRGAGHVVVIGAGIAGLAAAHRLVDRGARVTVLEAADRVGGKLLPGEIAGAR
VDLGAESMLARRPEAVALAREVGLADRLRPPATATASLWTRGALRPMPKGHVMGVPGTAS
ALAGVLSDEGLARIERDADLPRTEVGDDVAVGEYVAARLGREVVDRLVEPLLGGVYAGDA
YRISMRSAVPQLFQAALTHTSLTEAVRGIQERAAAAGQTGPVFMGIEGGIGRLPLAVAES
VRARGAEIRTRTSVTGLRREAPGGWRVVTGGTGGGEERVLRADAVVLAVPAPVAAALLRA
EAPGAAAELAGVEYASMALVTLAYRRAGLTLPEGSGFLVPPVDGRTIKASTFSSRKWGWL
AEENPDLLILRTSVGRYGETAILDHDDAHLVDVSRTDLREATGLTAAPVETRVTRWDDGL
PQYPVGHHARVTRVREYLSKLPGLAVCGAAYDGVGIPACVASATAAVDEIHGDLRALRDL
TADPVQSLHGGAGE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcaggtacggacgccgggcgcggcgccgggcacgtcgtcgtcatcggggcc
ggcatcgcggggctcgccgccgcgcacaggctggtggaccggggcgcgcgagtgaccgtc
ctggaggccgcggaccgcgtcggcggcaagctgctgcccggcgagatcgcgggcgcgcgc
gtcgacctcggcgccgagtcgatgctcgcccgccgccccgaggcggtcgccctcgcgcgc
gaggtgggtctcgccgaccggctccggccgccggccaccgccacggcctccctgtggacc
cggggcgccctgaggcccatgcccaagggccatgtcatgggggtccccggcaccgcgtcc
gcgctcgcgggggtcctgtccgacgagggcctggcccggatcgagcgcgacgccgacctg
ccgcgcaccgaggtcggcgacgacgtggcggtgggggagtacgtggcggcccgcctcggc
cgcgaggtcgtcgaccgtctggtggaacccctgctcggcggtgtctacgcgggcgacgcg
taccgcatctcgatgcgttcggccgtgccgcagctcttccaggcggcgctgacccacacc
tccctcaccgaggccgtccggggcatccaggagcgcgcggcggccgccgggcagaccggg
ccggtgttcatgggcatcgagggcgggatcggccggctgccgctcgcggtggccgagtcg
gtgcgggcccgcggcgccgagatccgtacccgcacgtccgtcaccggactgcgccgggag
gctcccggcggctggcgtgtcgtcaccggcggtacgggcggcggggaggagcgtgtcctg
cgcgccgacgccgtggtcctggccgtccccgccccggtcgccgccgccctcctgcgcgcc
gaggcccccggcgccgcggccgagctggcgggtgtggagtacgcctcgatggccctggtc
accctcgcctaccgccgggccggactcaccctgcccgagggcagcggcttcctggtgccg
ccggtcgacggccgcacgatcaaggcgtcgacgttctcctcccgcaagtggggctggctc
gccgaggagaacccggacctgctgatcctgcgcacctcggtcggccggtacggcgagacg
gcgatcctggaccacgacgacgcccacctcgtggacgtgtcgcggaccgacctgcgcgag
gccaccggcctgaccgccgccccggtcgagacccgcgtcacccgctgggacgacggcctg
ccccagtacccggtcggccaccacgcgcgcgtgacccgcgtccgcgagtacctgagcaag
ctgccgggcctcgcggtctgcggagcggcgtacgacggtgtcggcatccccgcctgcgtc
gcgagcgccaccgcggccgtcgacgagatccacggcgacctgcgcgcgctgcgggatctc
accgccgacccggtgcagagcctccacggcggagcgggagaatag

DBGET integrated database retrieval system