KEGG   Streptomyces scabiei: SCAB_25481Help
Entry
SCAB_25481        CDS       T01187                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
scb  Streptomyces scabiei
Pathway
scb00900  Terpenoid backbone biosynthesis
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01130  Biosynthesis of antibiotics
Module
scb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCAB_25481 (dxr)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SCAB_25481 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CBG69654
UniProt: C9Z262
Position
complement(2897920..2899203)
Genome map
AA seq 427 aa AA seqDB search
MSDSPAPLADPHLVFDPVDGARDVVILGSTGSIGTQAIDLVLRNPDRFRVTGLSAAGGRV
QLLAEQAHRLRVRTVAVAREDVVPALREALADTYGTGEALPEILAGPDAATALAASDCHT
VLNGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKAVAKPGQIIPVDSEHAALFQ
ALASGTRADVRKLVVTASGGPFRGRSKEELADVTPADALAHPTWAMGPVITVNSATLVNK
GLEVIEAHLLYDIPFDRIEVVVHPQSYVHSMVEFTDGSTMAQATPPDMRGPIAIGLGWPQ
RVPDAAPAFDWTKASSWEFFPLDDDAFPSVGLARHVGQLAGTAPAVFNAANEECVDAFLY
GGLRFDAIMETVTRVVEEHGTPASGTSLTVADVLEAETWARARARELTTSTTSTGKPTER
TTAEARA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagtccagcccctctcgccgatccgcatctcgtcttcgacccggtcgacggc
gcacgggacgtagtgatcctcggatcgaccggctcgatcggcacccaggccatcgacctc
gtcctgcgcaacccggaccgcttccgcgtcaccgggctctccgccgccggagggcgggtg
cagctcctggccgagcaggcgcaccggctgcgcgtgcggaccgtcgccgtcgcccgcgag
gacgtcgtaccggccctgcgcgaggccctggccgacacctacggcaccggggaggccctc
cccgagatcctggccggccccgacgcggccacggccctggccgcctccgactgccacacc
gtgctgaacggcatcaccggctccatcggcctcgccccgaccctcgccgccctggaggcg
ggccgcaccctcgcgctcgccaacaaggagtcgctcatcgtcggcggcccgctggtcaag
gcggtggcgaagcccggccagatcatcccggtcgactccgagcacgccgccctcttccag
gccctcgcctccggcacccgggccgacgtgcgcaagctcgtcgtcaccgcctccggcggc
ccgttccgcggccgcagcaaggaggaactggcggacgtgacccccgccgacgccctcgcg
caccccacctgggccatgggcccggtcatcaccgtgaactccgcgaccctggtcaacaag
ggcctggaggtcatcgaggcccacctgctctacgacattcccttcgaccgcattgaggtc
gtcgtgcacccccagtcgtatgtccactcgatggttgagttcacggacggatcgacgatg
gcccaggcgacgccccccgacatgcgcgggcccatcgccatcggcctcggctggccgcag
cgcgtcccggacgccgcgcccgccttcgactggaccaaggcgtccagctgggagttcttc
cccctcgacgacgacgcgttcccgtccgtcgggctcgcccggcacgtgggacagctcgcg
ggcaccgccccggcggtgttcaatgcggcgaacgaggagtgcgtcgacgcgttcctgtac
gggggtctccggttcgacgcgatcatggagaccgtcacacgggtggtcgaggagcacggc
acccccgcctcgggaacttccctgaccgtggcggacgtcctcgaagcggagacctgggca
cgtgccagggcccgcgaactgaccacctcgaccacctcgaccggcaaacccaccgagcgg
acgaccgcggaggcccgtgcatga

DBGET integrated database retrieval system