KEGG   Streptomyces scabiei: SCAB_28011Help
Entry
SCAB_28011        CDS       T01187                                 

Gene name
glgB1
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scb  Streptomyces scabiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCAB_28011 (glgB1)
Enzymes [BR:scb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCAB_28011 (glgB1)
Exosome [BR:scb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCAB_28011 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3196595..3199756
Genome map
AA seq 1053 aa AA seqDB search
MKKTAAKKTAAKKAVAKTATAKKTATKKAAQESTKKSVEVEAAVGEPAPGRAAGTGGATA
KAPAKKTAATKKAVAKKAATKKAVVKTAATKTAAATKTPAKSAASKKAAAAKSVAEKAQV
EEAVAEKAVAESAVTAEAAAEKPLAKKAVTKKAAAKKAAAKKPVAKRVAAKTAAVRKTPA
VKKTAAVKEPATVEKTAAKKAGVKKAGVKKQAAARKATPPEDVVTTEAAARRAVAGKAVT
SPRQAERAVLVPALPPGGGTPPPAPVSAGSPAPEPVLPQQAAAEPAVPPRAAAEPASPHP
SVPRQETPAQDTAPHDDPALAHPVVSPAMDGGDRERLLAGTHHAPHSVLGAHPVPGGVVF
RVFRPYALGVSVVVDTLRAELHDDGGGFYSALLPLREVPSAYRLLVSYEGAVQETEDAYR
FLPAIGELDLYLIGEGRHEELWKALGAEPMTHQGVTGTRFTVWAPNALGVRLAGTFNFWD
ATGYPMRALGSSGVWELFVPGIGEGELYKFEITRPDGSKTLRADPMARRTEVPPNTSSVI
HASGYEWNDEEWLARRTQTPAHEAPFSVYEVHLPSWRPGLTYRQLAEQLPAYVSDLGFTH
VELLPIAEHPFGGSWGYQVTGFYAPTARLGTPDDFKYLVDALHRAGIGVLMDWVPAHFPR
DDWALAEFDGRPLYEHADPQRAAHPDWGTLEFDYGRREVRNFLVANAVYWCEEYHIDGLR
VDAVASMLYLDYSREPGQWTPNEHGGRENLDAVAFLQEMNATVYRRVPGVVTIAEESTAW
DGVTRATHHNGPGGFGGLGFGLKWNMGWMHDSLDYMAKDPVHRKHHHHEMTFSMVYAYSE
NYVLPISHDEVVHGKGSLVSKMPGDWWQRRANHRAYLGFMWAHPGKQLLFMGQEFAQGAE
WSEAHGPDWWLLDPAYGAEADHRGVRDLVRDLNAEYRRTPALWQQDTRPAGFSWITGDSA
DDNVLAFLRFAEDGTPLLAVSNFSPVVREEYRLGVPEDVPAWREVLNTDAAAYGGSDSTG
SAPVKPDPQPWHARPASIRVTLPPLSTVWLRPA
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagacggccgcgaagaagacggccgcgaagaaagccgtggcgaagacggcgacc
gcgaagaagacggcgacgaagaaggcggcgcaggagtcgacgaagaagtcggtcgaggtc
gaggcggccgtcggcgagcccgcgcccgggcgtgccgccggaaccgggggtgcgaccgcg
aaggccccggccaagaagacggcggcgacgaagaaggccgtggcgaagaaggcggcgacg
aagaaggccgtggtgaagacagccgcgacgaagaccgccgcggcgacgaagacccccgcg
aagtcggccgcctcgaagaaggcggcagcggccaagtccgtggcggagaaggcccaggtt
gaggaggccgtggcggagaaggccgttgcggagtcggccgtcaccgccgaggcggcggcc
gagaagcccttggcgaagaaggccgtcacgaagaaggcagccgcgaaaaaggcagccgcc
aagaagccggtcgccaagcgggtcgccgccaagaccgcggcggtgaggaagacccctgcc
gtgaagaagaccgcggcggtgaaggaacccgcaaccgtggagaagaccgccgccaagaag
gcgggggtcaagaaggccggggtcaagaagcaggcggcggccaggaaggccacaccgccc
gaggacgtcgtcacgaccgaggccgccgcccggcgtgccgtcgccgggaaggcggtgacg
tcgccgcggcaggcggagcgcgcggtgctggtcccggccctcccgccgggcggtgggacg
cctccccccgccccggtgtcggccggatcaccggccccggagcccgtgctgccccagcag
gccgccgccgaaccggccgtccccccgcgggccgccgccgaaccggcgtcgccgcacccg
tcggtccccagacaggagacccccgcgcaggacaccgccccccacgacgaccccgccctc
gcccaccccgtcgtctcccccgcgatggacggcggcgaccgtgaacggctgctggccggg
acccatcacgcgccgcactccgtgctgggtgcccatcccgtgcccggcggtgtggtgttc
cgggtgttccggccctacgcgctcggcgtgagcgtggtggtggacacgctgcgggcggag
ctgcacgacgacgggggcggcttctactcggcgctgctgccgctgcgggaggtgccgtcg
gcataccggttgctggtgtcgtacgagggcgccgtgcaggagacggaggacgcctaccgc
ttcctgcccgcgatcggcgagctggatctgtacctgatcggcgaggggcgccacgaggag
ctgtggaaggcgctcggcgccgagccgatgacccaccagggcgtgaccggcacccgcttc
accgtgtgggccccgaacgcgctcggcgtgcgcctggccgggaccttcaacttctgggac
gccacggggtaccccatgcgtgcgctgggctcctcgggtgtgtgggagctgttcgtgccg
gggatcggcgagggcgagctgtacaagttcgagatcacccggccggacggttcgaagacg
ctgcgggccgacccgatggcccgccgcacggaggtcccgccgaacacctcgtccgtcatc
cacgcctcggggtacgagtggaatgacgaggagtggctcgcccggcgcacgcagaccccc
gcgcacgaggcgccgttctcggtctacgaggtgcatctgccgtcctggcgaccgggcctg
acgtaccggcagctggcggagcagctcccggcgtacgtctccgacctcggcttcacccat
gtggaactgctgccgatcgccgagcaccccttcggcggctcctggggctaccaggtcacc
ggcttctacgccccgaccgcccggctcggcacccccgacgacttcaagtacctggtcgac
gccctgcaccgggccggcatcggtgtgctgatggactgggtgccggcccacttcccgcgg
gacgactgggcgttggcggagttcgacggacgtccgctgtacgagcacgcggacccgcag
cgggcggcgcaccccgactgggggacgctggagttcgactacggccgccgtgaggtgcgc
aacttcctggtggccaacgcggtgtactggtgcgaggagtaccacatcgacgggctgcgg
gtggatgccgtcgcgtcgatgctgtacctcgactactcgcgcgagccgggccagtggacg
ccgaacgagcacgggggccgggagaacctggacgcggtcgccttcctccaggagatgaac
gcgaccgtgtaccggcgggtgccgggtgtcgtgacgatcgcggaggagtccacggcctgg
gacggtgtcacccgggccacccaccacaacggccccggcggcttcggcggtctcggtttc
ggcctgaagtggaacatgggctggatgcacgactcactggactacatggccaaggacccc
gtccaccgcaagcaccaccaccacgagatgaccttctcgatggtgtacgcgtacagcgag
aactacgtcctgcccatctcccacgacgaggtcgtgcacggcaagggttccctggtgtcg
aagatgccgggcgactggtggcagcggcgggcgaaccaccgggcgtacctgggcttcatg
tgggcccaccccggcaagcaactcctcttcatgggacaggagttcgcgcagggggccgag
tggtcggaggcgcacgggccggattggtggctgctcgatcccgcgtacggcgccgaggcc
gaccaccggggagtgcgcgacctggtccgcgacctcaacgcggagtaccgccggacgccg
gcgctctggcagcaggacacccggcccgcgggcttctcctggatcacgggggactccgcg
gacgacaacgtcctggcgttcctgcggttcgccgaggacggtacgccgctgctggccgtc
tccaacttcagcccggtggtccgggaggagtaccggctcggtgtccccgaggacgtcccg
gcctggcgcgaggtgctgaacaccgacgcggcggcctacggcgggtcggactcgacgggc
tcggcccccgtgaaacccgacccccagccctggcacgcccgcccggccagcatccgggtc
acgctcccgcctctctccaccgtttggctccgcccggcctga

DBGET integrated database retrieval system