KEGG   Streptomyces scabiei: SCAB_28201Help
Entry
SCAB_28201        CDS       T01187                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
scb  Streptomyces scabiei
Pathway
scb00010  Glycolysis / Gluconeogenesis
scb00030  Pentose phosphate pathway
scb00051  Fructose and mannose metabolism
scb00052  Galactose metabolism
scb00680  Methane metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_28201 (pfkA2)
   00030 Pentose phosphate pathway
    SCAB_28201 (pfkA2)
   00051 Fructose and mannose metabolism
    SCAB_28201 (pfkA2)
   00052 Galactose metabolism
    SCAB_28201 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    SCAB_28201 (pfkA2)
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCAB_28201 (pfkA2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SCAB_28201 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: CBG69920
UniProt: C9Z6Y0
Position
complement(3222935..3223960)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTAGGDCPGLNAVIRSVVHRAVAQYGDEVIGFEDGYAGLLDGRYRTLDLESVSGI
LARGGTMLGSSRLQRDRLREACESAQDMAHRFGIDVLIPIGGEGTLTAARMLSDAGLPVV
GVPKTIDNDISSTDRTFGFDTAVGVATEAMDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAAGAHGICLPERAFDPADLVKMVEERFARGKKFAVICVAEGAHPAEGSMDYGHGEIDQ
FGHERFQGIGAALAYELERRLGKEAKPVILGHIQRGGTPTAYDRVLATRFGWHAVEAAHR
GDYGRMTALRGTDVVMVPLAEAVTELKTVPKDRMDEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggagttctcaccgcaggcggcgactgtccgggcctgaacgcagtgatccgg
tcggtcgtgcaccgagcggtcgcccagtacggcgacgaggtcatcggcttcgaggacggc
tacgccggactgctcgacggccgctaccgcaccctcgacctggagtccgtcagcggcatc
ctcgcccgcggcggcaccatgctcggctcctcccgcctccagcgcgaccgcctccgcgag
gcgtgcgagagcgcgcaggacatggcacaccggttcggtatcgacgtactgatcccgatc
ggcggcgagggcacgctgacggccgcgcggatgctgtcggacgcgggcctgccggtggtc
ggcgtcccgaagaccatcgacaacgacatctcctcgacggaccgcaccttcggcttcgac
acggcggtcggggtcgccacggaggcgatggaccgcctgaagaccaccgccgagtcccac
cagcgtgtgatggtggtcgaggtcatgggccggcacgcgggctggatcgcgctggagtcc
gggatggcggcgggcgcgcacggcatctgcctgcccgagcgcgccttcgacccggccgac
ctggtgaagatggtcgaggagcgcttcgcgcgcggcaagaagttcgcggtcatctgtgtc
gcggagggcgcccaccccgccgagggctcgatggactacggccacggcgagatcgaccag
ttcgggcacgagcgcttccagggcatcggtgccgcgctcgcctacgaactggagcggcgc
ctcggcaaggaggccaagcccgtcatcctcggccacatccagcggggcggcaccccgacc
gcctacgacagggtgctcgccacacgcttcggctggcacgcggtggaggccgcgcaccgc
ggcgactacggccggatgaccgccctgcgcggcaccgacgtggtgatggtgccgctggcg
gaggcggtgaccgagctgaagacggtgcccaaggaccgcatggacgaggcggagtcggtg
ttctag

DBGET integrated database retrieval system