KEGG   Streptomyces scabiei: SCAB_28951Help
Entry
SCAB_28951        CDS       T01187                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
scb  Streptomyces scabiei
Pathway
scb00260  Glycine, serine and threonine metabolism
scb00750  Vitamin B6 metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01230  Biosynthesis of amino acids
Module
scb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_28951 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAB_28951 (thrC)
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAB_28951 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: CBG69994
UniProt: C9Z8G7
Position
complement(3298671..3299729)
Genome map
AA seq 352 aa AA seqDB search
MTHQWRGIIEEYRDRLPVSDSSPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGANPTGS
FKDRGMTMAITRAKEEGAKAVICASTGNTSASAAAYAVRAGMVSAVLVPRGKIALGKMGQ
ALVHGAKILQVDGNFDDCLTLARELSDNYPVALVNSVNPVRIEGQKTAAFEIVDMLGEAP
DIHVLPVGNAGNITAYWKGYTEYAADGIASRTPRMWGFQASGSAPIVRGEVVKDPSTIAT
AIRIGNPASWNYALAARDESGGLIDEVTDREILRAYRLLAAQEGVFVEPASAASVAGLLK
AAELGKVDPGQTIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAATAAERLGLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccagtggcgcggaatcatcgaggagtaccgggaccggctgcccgtctccgac
agctcgccggtcgtgacgctccgggagggcggcacgcccctcgtacccgcgcaggtgctc
tccgagcgcacgggctgcgaggtgcacctcaaggtcgagggtgccaacccgaccgggtcc
ttcaaggaccggggcatgaccatggccatcacgcgggcgaaggaggagggcgccaaggcg
gtcatctgtgcctccacgggcaacacctccgcctccgcggccgcctacgcggtccgcgcg
ggcatggtctccgccgtgctcgtcccgcgcgggaagatcgcgctgggcaagatgggccag
gccctcgtgcacggcgcgaagatcctccaggtcgacggcaacttcgacgactgcctcacc
ctggcgcgtgaactgagcgacaactacccggtggcgctggtcaattcggtgaacccggtg
cgcatcgagggccagaagaccgccgcgttcgagatcgtggacatgctcggcgaggccccc
gacatccacgtcctgccggtgggcaacgcgggcaacatcacggcgtactggaagggctac
acggagtacgccgccgacgggatcgcgtccaggaccccgcgcatgtggggattccaggcg
tccggttccgcgcccatcgtgcgcggcgaggtcgtcaaggacccgtcgacgatcgccacc
gcgatccgcatcggcaaccccgcgtcctggaactacgccctggccgcgcgggacgagtcg
ggcggcctcatcgacgaggtgacggaccgtgagatcctgcgcgcctaccggctgttggcc
gcgcaggagggcgtcttcgtggagcccgcctccgccgcctcggtggccggtctgctgaag
gccgcggagctgggcaaggtcgacccgggccagacgatcgtctgcacggtcaccggcaac
ggcctcaaggaccccgactgggccgtcgcgggcgccccgcagcccgtcaccgtcccggtc
gacgcggcgacggcggccgagcgcctcggtctcgcctga

DBGET integrated database retrieval system