KEGG   Streptomyces scabiei: SCAB_30161Help
Entry
SCAB_30161        CDS       T01187                                 

Definition
sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scb  Streptomyces scabiei
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_30161
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SCAB_30161
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCAB_30161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3430380..3431918)
Genome map
AA seq 512 aa AA seqDB search
MSPTTFATGSPGSHSGQDGLARDALTVLQPGFTGTTAPDWLLRRLGEGLASVGLFGRNIT
SPGQLAALTARLRAEHEDVLVAIDEEGGDVTRLEVHAGSSFPGNHALGAVDDVALTRDVA
FALGRRLAECGVNLNWAPSADVNANPSNPVIGVRSFGADPALVARHTAAYVTGLQDAGVA
ACTKHFPGHGDTAVDSHHFLPRIDADRSLVDSRDLAPFRAAIAAGSRAVMSAHILVPALD
PDLPATLSRGILTDLLRGALGYDGLIVTDGMEMRAIAGTYGIERGSVLALAAGADAICVG
GGLADEETVLRLRDALVTAVRDGDLEEERLADAARRVRALATWTRSAAETPGGTAGADTE
IGLVAARRALTVTRAQSYEPPTQPLYVAAFAPVANIAVGDETPWGVGAELARLVPGTETG
TFAGDSAGASALSVAGTRRVVAVVRDEHRHPWMTAALDLLLGTRPDTIVVEMGIPQAPPR
GALHIATHGAARVCGRAAAEVIAGVPREPERG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgacgacattcgccaccggctcgcccggctcgcactccggacaggacggcctc
gcgcgggacgcgctgacggtgctgcagcccggcttcacgggcaccaccgcccccgactgg
ctgctgcggcgcctcggcgagggcctcgcctccgtcggcctcttcggccgcaacatcacc
tcgcccggacagctggccgccctcaccgcccggctgcgcgccgagcacgaggacgtcctc
gtcgcgatcgacgaggagggcggcgacgtcacccgcctggaggtgcacgccggctcctcc
ttcccgggcaaccacgccctgggcgcggtcgacgacgtggccctgaccagggacgtcgcc
ttcgccctcggccgccgcctggcggagtgcggcgtcaacctcaactgggcgccctcggcc
gacgtgaacgccaacccctccaacccggtcatcggggtccgctccttcggcgccgatccc
gccctggtcgcccgccacacggccgcctacgtcacggggctccaggacgcgggggtcgcc
gcctgcaccaagcacttccccggccacggcgacaccgccgtcgactcccaccacttcctg
ccccgcatcgacgcggaccgctcgctcgtggactcccgggacctggcccccttccgcgcc
gccatcgccgccggctcccgcgcggtgatgagcgcccacatcctggtcccggccctggac
cccgaccttccggcgacgctctcccgcggcatcctcacggacctcctgcgcggcgcactc
ggctacgacgggctcatcgtcaccgacggcatggagatgcgggccatcgcgggcacctac
ggcatcgaacgcggcagcgtcctcgcgctggccgcgggggccgacgccatctgcgtcggc
ggtggcctcgccgacgaggagaccgtcctccgcctgcgcgacgccctcgtcacggccgtg
cgcgacggcgacctcgaggaggaacgcctggcggacgcggcgcggcgggtccgggcgctg
gcgacctggacccggtcggcggccgaaacccccggcgggaccgccggcgccgacacggag
atcggtctcgtggccgctcgccgcgccctgacggtcacccgcgcacagtcctacgagccg
cccacccagcccctctacgtcgcggccttcgcgccggtcgccaacatcgccgtgggcgac
gagaccccctggggcgtcggcgcggaactggcccgcctcgttcccggcaccgagacgggc
accttcgccggcgacagcgccggagcctcggccctgtcggtcgcgggcacccgccgtgtg
gtcgccgtcgtccgggacgaacaccgccacccgtggatgaccgcggccctcgacctgctc
ctcggcacccgcccggacacgatcgtcgtggagatgggcatcccccaggccccaccccga
ggcgccctccacatcgcgacccacggcgcggcccgggtctgcggccgggcggcggcggag
gtcatcgccggcgtcccccgggagccggagcgcggctga

DBGET integrated database retrieval system