KEGG   Streptomyces scabiei: SCAB_31211Help
Entry
SCAB_31211        CDS       T01187                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scb  Streptomyces scabiei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3539618..3540478
Genome map
AA seq 286 aa AA seqDB search
MLRLGKREFGPHEPVIMAIVNRTPDSFYDQGATFQDEPALARVEQAVAEGAAIVDIGGVK
AGPGEDVSAAEEARRTVGFVAEVRRRFPEVVISVDTWRHDVGEAVCEAGADVLNDAWGGV
DPRLAEVAGRYRAGLVCTHAGGAQPRTRPHRVEYDDVMADILRVTVGLAERAVALGVPRE
SVMIDPGHDFGKNTRHSLEATRRLGEMVATGWPVLVSLSNKDFVGETLDRPVKERVVGTL
ATTAVSAWLGAQVYRVHEVAETRQVVDMVASIAGHRAPAVARRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctgggcaagcgggaattcggcccccacgagccggtgatcatggcgatcgtg
aaccggaccccggactcgttctacgaccagggggccaccttccaggacgagccggcgctc
gcgcgcgtggagcaggcggtcgccgagggcgccgccatcgtggacatcggcggggtcaag
gccggtcccggggaggacgtgagcgcggcggaggaggcgcggcggaccgtggggttcgtc
gccgaggttcggcggcggttccccgaggtcgtcatcagcgtcgacacctggcggcacgat
gtcggcgaggccgtgtgcgaggccggggcggacgtgctgaacgacgcgtggggcggggtc
gatccccggctcgcggaggtggcggggcggtaccgggcgggactggtgtgcacgcacgcg
ggtggggcgcagccccgtacacggccgcaccgggtcgagtacgacgacgtgatggccgac
atcctgcgggtgaccgtggggctggcggagcgggcggtggcgctgggggtgccccgggag
tcggtgatgatcgatcccgggcacgacttcgggaagaacacgcggcacagcctggaggcg
acccggcggctcggcgagatggtcgcgacggggtggccggtgctggtgtcgctgtccaac
aaggacttcgtgggcgagacgctggaccggccggtgaaggaacgggtggtggggacgctg
gccaccaccgccgtctccgcctggctgggggcccaggtgtaccgggtgcatgaagtggcg
gagacccggcaggtggtggacatggtggcgtcgatcgcggggcaccgggcgcccgcggtg
gcccggcgggggctggcctag

DBGET integrated database retrieval system