KEGG   Streptomyces scabiei: SCAB_31711Help
Entry
SCAB_31711        CDS       T01187                                 

Definition
pyridoxal-phosphate dependent protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scb  Streptomyces scabiei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAB_31711
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAB_31711
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAB_31711
Enzymes [BR:scb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAB_31711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3595017..3595979
Genome map
AA seq 320 aa AA seqDB search
MNSLWRYAECLPLASPTVSLGEGRTPLVELKDGIRAKLDFLMPTLSFKDRGAVLLAELAL
RLGPRRVIADSSGNAGTAVAAYCARAALPCTVYVPAGTSDKKLEQIGAHGAQVHLVDGGR
EAAARAAREAADADGVFYASHVYNPYFLHGTKTYVHELWEDLGGRLPEVIVVPVGNGTLL
LGAALAVTELHAAGLIDRRPALCAVQSAAVAPLAHAWTEGADDLVGNTTTAPTLAEGIAI
PRPPRARQILRAVRDSGGTFLTVTEDQLRHAQRDLASRGLYVESTGVACWAAVREGTLGS
RSAVVPLCGAGLKTGLAGGQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgctctggcgctacgcggaatgcctccccctggcctcccccacggtctccctc
ggcgagggccggacgccgctcgtcgagctgaaggacggcatccgggccaagctcgacttc
ctgatgccgacgctctccttcaaggaccggggcgcggtactcctcgccgaactggcactg
cggctcggcccccggcgggtgatcgccgacagcagcggcaacgcgggcacggcggtggcc
gcgtactgcgcccgggccgcgctgccctgcacggtgtacgtcccggccggcacgtcggac
aagaagctggagcagatcggggcgcacggcgcgcaggtccacctcgtcgacggcggccgc
gaggccgcggcccgcgcggcccgggaggcggcggacgcggacggcgtgttctacgcctcg
cacgtctacaacccgtacttcctgcacggcaccaagacgtacgtccacgaactgtgggag
gacctcggcggcagactccccgaggtgatcgtcgtccccgtcggcaacggcacgctgctg
ctgggcgcggccctcgccgtgaccgagctgcacgcggcgggcctcatcgaccgccgcccg
gccctctgcgccgtgcagtcggccgccgtcgcgccgctggcccacgcctggacggagggc
gcggacgacctggtcgggaacaccaccacggctcccaccctcgccgagggcatcgccatc
ccccgcccgccccgcgcccgccagatcctccgcgccgtccgcgactccggcggcaccttc
ctcaccgtgaccgaggaccagctccgccacgcccagcgcgacctggcctcccgcggcctg
tacgtcgagtccacgggcgtggcctgctgggcggccgtacgggaggggacgctggggtca
cgctcggcggtggtgccgctgtgcggcgccgggctgaagacgggcctggcggggggtcag
tag

DBGET integrated database retrieval system