KEGG   Streptomyces scabiei: SCAB_32011Help
Entry
SCAB_32011        CDS       T01187                                 

Definition
protein methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
scb  Streptomyces scabiei
Brite
Enzymes [BR:scb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SCAB_32011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3629681..3630922
Genome map
AA seq 413 aa AA seqDB search
MTDVTASSPSAVKLRDKLVNELVAQHVIQTKEVEAAFREVPRHVFAPEAPLEKAYAQTHL
ATKRDDHGITISSVSAPEIQATMLEQAGLRPGHRCLEIGSGGYNAALMASLVGENGEVTT
IDIDEDVTDRARACLKNAGYPQVNVVRTDGEDGCAEHAPYDRTIVTVGSWDIPPAWVEQL
ADGGTITVPLRMRGLTRSITFAREGDHLVSQSAKICGFVTMQGAGAHQERLLLLRGKEIG
LRFDDEWPTEPDALNGALDTERVEVWSGVKIQRHEQFDTLQMWLATALDDFCLLAVDPKL
DTGLLSPQNKMACPAVVEGGSFAYLALRKLGTEPDPVFEFGAHAFGPDAAALADTLAEQI
RVWSRDHRGGRGPSIAAYPADTPDDRLPEGRVINKRHVRVLISWPTEDLPPAS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgtgaccgctagctcgccctcagcagtaaaactgcgagacaaactcgtgaat
gagctcgtggcccagcacgtgatccagaccaaggaggtcgaagcggcgttccgtgaggtg
cccaggcacgtgttcgcccccgaagctcctctggagaaggcgtatgcccagacccatctg
gcgacgaagcgggatgaccacggcatcacaatcagctcggtatccgctccggaaatccag
gccaccatgctggaacaggcggggcttcggccgggtcaccgttgcctggaaatcggctcc
ggcggctacaacgccgcgctgatggcctctctggtcggcgagaacggcgaggtcacaacg
atcgacatcgacgaagatgtcactgaccgagcccgcgcctgcctgaagaacgccggatac
ccgcaagtaaacgtcgtccgcacggatggcgaggacgggtgcgccgagcacgccccctac
gaccggacgatcgtcaccgtcggcagctgggacatccctccggcatgggtggagcagctc
gccgacggcggaaccatcaccgtcccgctgcggatgcggggcctgacccgatcgatcacc
ttcgcccgggaaggagatcacctggtcagccagtcggcgaagatctgcggattcgtcacg
atgcagggagccggagcccaccaggaacggctgctgctcctgcgcggcaaggagatcggt
ctgcggttcgacgacgagtggccgaccgaaccggacgcgctgaacggtgcgctcgacacc
gagcgggtcgaggtgtggtcgggggtgaagatccaacgccacgagcagttcgacacgctc
cagatgtggctggccaccgccctggacgacttctgtctcctcgcagtcgacccgaagctg
gacacgggcctgctctccccccagaacaagatggcctgcccggccgtggtcgagggcggc
agcttcgcctatctcgccctgcggaagctgggcacagaaccagatcccgtgttcgagttc
ggagcacacgccttcggtcccgacgccgccgcgctcgccgacaccttggccgagcagatc
cgtgtctggagccgtgaccaccgcggcgggcgcggcccgagcatcgcggcctacccggcc
gacacacccgatgaccggctccccgaggggcgagtcatcaacaagcggcatgtccgcgtc
ctcatctcctggccgacggaggacttgcctccggcgagctag

DBGET integrated database retrieval system