KEGG   Streptomyces scabiei: SCAB_33461Help
Entry
SCAB_33461        CDS       T01187                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
scb  Streptomyces scabiei
Pathway
scb00010  Glycolysis / Gluconeogenesis
scb00520  Amino sugar and nucleotide sugar metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
Module
scb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_33461 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_33461 (ppgK)
Enzymes [BR:scb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SCAB_33461 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CBG70443
UniProt: C9ZF59
Position
complement(3776873..3777619)
Genome map
AA seq 248 aa AA seqDB search
MHIFGVDIGGSGIKGAPVDLDLGDLADERHKVLTPHPATPDAVADGVKEVVGHFGWTGPV
GITFPGVVTGGATIRTAANVDKSWIDVDAAALLSERIGGLPVTVVNDADAAGVAEVQFGA
GRDRQGTVILLTFGTGIGSAVFSDGVLVPNTELGHLELHGHDAETRASTKAKEDHELTWE
HWAKRVTKYLAHVEMLFSPELFIIGGGVSRKSAKFLHLIEGIRAEIVPAQLQNNAGIVGA
AMRAAKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcttcggcgtggacatcggtggttccgggatcaagggcgctcccgtggacctg
gacctgggcgacctggcggacgagcgacacaaggtgctgaccccgcacccggcgacgccc
gacgcggtcgccgacggggtcaaggaggtcgtcggccacttcggctggaccggcccggtc
ggcatcaccttccccggcgtggtcaccggcggcgccacgatccggacggcggccaacgtc
gacaagagctggatcgacgtcgacgcggccgccctgctgagcgagcggatcggcggcctg
ccggtgaccgtggtcaacgacgcggacgcggcgggcgtggccgaggtccagttcggcgcc
gggcgcgaccggcagggcacggtcatcctgctcaccttcggcacgggcatcggcagcgcc
gtcttctccgacggcgtcctcgtccccaacaccgagctgggccacctggagctgcacggc
cacgacgccgagacccgcgcctccaccaaggccaaggaggaccacgagctgacctgggag
cactgggccaagcgcgtcaccaagtacctcgcccacgtcgagatgctcttctcacccgag
ctcttcatcatcggcggcggcgtcagccgcaagtcggcgaagttcctgcacctcatcgaa
ggcatcagggcggagatcgtcccggcccagctgcagaacaacgcgggcatcgtgggcgcg
gcgatgcgggcggcgaaggccggctag

DBGET integrated database retrieval system