KEGG   Streptomyces scabiei: SCAB_34921Help
Entry
SCAB_34921        CDS       T01187                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
scb  Streptomyces scabiei
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCAB_34921 (deoA)
Enzymes [BR:scb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SCAB_34921 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3935968..3937269)
Genome map
AA seq 433 aa AA seqDB search
MTKPTTMSMDAISVIRTKRDRGELSDEQIDWVIDAYTRGEVADYQMAALNMAILLNGMDR
REIARWTAAMIASGERMDFSSLSRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGR
GLGHTGGTLDKLESIPGWRALLSNEEMLNVLDEVGAVICAAGDGLAPADKKLYALRDVTG
TVEAIPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKTLEDARELASTMVGLGTDHGVKT
VALLTDMSTPLGLTAGNALEVRESVEVLAGGGPADVVELTIALAREMLDAAGVKDADPAK
ALADGSAMDAWRRMIAAQGGDPDAPLPTSREQHVVKAAASGVLTRLDAYDIGIAAWRLGA
GRARKEDPVQAAAGVELHAKPGDTVTEGQPLLTLHTDTPERFDYALEAVAGSYDIGAPGT
AYEPTPIVLDRIA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagccgaccacgatgtcgatggacgccatctcggtcatccgcaccaagcgggac
cgcggcgaactcagcgacgagcagatcgactgggtcatcgacgcgtacacccgcggcgag
gtcgccgactaccagatggccgccctcaacatggcgatcctcctcaacggcatggaccgc
cgggagatcgcccgctggactgccgcgatgatcgcctccggtgagcgcatggacttctcg
tccctgtcccgtcccaccgccgacaagcactccacgggcggcgtcggagacaagatcacc
ctcccgctcgcccccctggtggcggcctgcggcgcggccgtcccccagctctcgggccgc
ggcctcggccacaccggcggcaccctcgacaagctggagtccatccccggctggcgcgcc
ctgctctccaacgaggagatgctgaacgtcctggacgaggtcggcgcggtcatctgcgcc
gcgggcgacggtctggccccggcggacaagaagctctacgcgctccgcgacgtcaccggc
acggtcgaggccatcccgctgatcgcctcctccatcatgtccaagaagatcgccgagggc
accggctcgctggtcctggacgtgaaggtcggcagcggtgccttcatgaagaccctggag
gacgcgcgcgaactggcgtccacgatggtcggcctgggcacggaccacggcgtgaagacg
gtcgccctcctcacggacatgtcgacccccctcggcctcaccgccggcaacgccctggag
gtccgcgagtcggtcgaggtcctggcgggcggcggcccggcggatgtcgtggagctgacg
atcgccctggcccgagagatgctcgacgcggccggtgtgaaggacgccgacccggcgaag
gcgctggccgacggctcggcgatggacgcgtggcgccgcatgatcgcggcccagggcggc
gaccccgacgccccgctcccgacctcgcgcgagcagcacgtggtgaaggcggccgcctcc
ggcgtcctgacccgcctcgacgcctacgacatcggcatcgccgcctggcgtctcggcgcc
ggacgcgcccgcaaggaggacccggtgcaggccgccgcgggcgtcgagctgcacgccaag
cccggcgacacggtcaccgagggccagcccctgctgaccctgcacaccgacacccccgag
cgtttcgactatgccctggaggccgtcgcgggctcgtacgacatcggcgcccccggcacc
gcgtacgagccgacgccgatcgtgctggaccgcatcgcctga

DBGET integrated database retrieval system