KEGG   Streptomyces scabiei: SCAB_35281Help
Entry
SCAB_35281        CDS       T01187                                 

Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
scb  Streptomyces scabiei
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAB_35281
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAB_35281
   00650 Butanoate metabolism
    SCAB_35281
  Energy metabolism
   00190 Oxidative phosphorylation
    SCAB_35281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3978641..3979132
Genome map
AA seq 163 aa AA seqDB search
MSATETTASGIGPVEGAGELSGYSPDNPAPFIEPPRKRTKKTPKSTRGNFEMAAWLFMRL
SGVVLVVLVIGHLIIQLVLDGGVSKIGFAFVAGRWASPFWQTWDLLMLWLAMLHGANGLR
TVINDYAERPNTRLWLKGLLYTATVFTILLGTLVIFTFDPNIR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccactgaaaccaccgcatccggcatcggccccgtcgagggcgccggggagctg
tcgggctacagccccgacaacccggcccccttcatcgagccgccccgcaagcgcaccaag
aagaccccgaagtcgacccgcggcaacttcgagatggccgcctggctcttcatgcggctg
tccggcgtcgtcctggtcgtcctggtcatcggccacctgatcatccagctcgtcctcgac
ggcggcgtctccaagatcggcttcgcgttcgtcgcgggccgctgggcgtccccgttctgg
cagacctgggacctgctgatgctgtggctcgcgatgctgcacggcgcgaacggcctgcgc
acggtcatcaacgactacgcggagcgcccgaacacccgcctgtggctgaagggcctgctc
tacaccgccacggtgttcaccatcctgctgggcacgctggtgatcttcaccttcgacccg
aacatccgctag

DBGET integrated database retrieval system