KEGG   Streptomyces scabiei: SCAB_35281Help
Entry
SCAB_35281        CDS       T01187                                 

Definition
(GenBank) putative succinate dehydrogenase membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
scb  Streptomyces scabiei
Pathway
scb00020  Citrate cycle (TCA cycle)
scb00190  Oxidative phosphorylation
scb00650  Butanoate metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
Module
scb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
scb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAB_35281
   00650 Butanoate metabolism
    SCAB_35281
  Energy metabolism
   00190 Oxidative phosphorylation
    SCAB_35281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CBG70619
UniProt: C9YTC2
Position
3978641..3979132
Genome map
AA seq 163 aa AA seqDB search
MSATETTASGIGPVEGAGELSGYSPDNPAPFIEPPRKRTKKTPKSTRGNFEMAAWLFMRL
SGVVLVVLVIGHLIIQLVLDGGVSKIGFAFVAGRWASPFWQTWDLLMLWLAMLHGANGLR
TVINDYAERPNTRLWLKGLLYTATVFTILLGTLVIFTFDPNIR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccactgaaaccaccgcatccggcatcggccccgtcgagggcgccggggagctg
tcgggctacagccccgacaacccggcccccttcatcgagccgccccgcaagcgcaccaag
aagaccccgaagtcgacccgcggcaacttcgagatggccgcctggctcttcatgcggctg
tccggcgtcgtcctggtcgtcctggtcatcggccacctgatcatccagctcgtcctcgac
ggcggcgtctccaagatcggcttcgcgttcgtcgcgggccgctgggcgtccccgttctgg
cagacctgggacctgctgatgctgtggctcgcgatgctgcacggcgcgaacggcctgcgc
acggtcatcaacgactacgcggagcgcccgaacacccgcctgtggctgaagggcctgctc
tacaccgccacggtgttcaccatcctgctgggcacgctggtgatcttcaccttcgacccg
aacatccgctag

DBGET integrated database retrieval system