KEGG   Streptomyces scabiei: SCAB_35801Help
Entry
SCAB_35801        CDS       T01187                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
scb  Streptomyces scabiei
Pathway
scb00020  Citrate cycle (TCA cycle)
scb00640  Propanoate metabolism
scb00660  C5-Branched dibasic acid metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
Module
scb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAB_35801 (sucC)
   00640 Propanoate metabolism
    SCAB_35801 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SCAB_35801 (sucC)
Enzymes [BR:scb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCAB_35801 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBG70671
UniProt: C9YUT7
Position
complement(4039958..4041136)
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQARDLFAKHDVPVLAGEVIDTPEAARAATERLGGKSVVKAQVKVGGRGKAGGVK
LAATADEAVEHATNILGMDIKGHTVHKVMIAETAPEIVEEYYVSYLLDRTNRTFLSIASV
EGGMEIEEVAATRPEAVAKTPIDANEGVTPEKAREIVEAANFPAEVADKVVNVLVTLWKT
FIEEDALLVEVNPLAKVASGDVIALDGKVSLDENADFRHPDHEELVDHAAANPLEAAAKE
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAAVMANGL
EIILGDPDVKSVFVNVFGGITACDEVANGIVQALQLLKDKGEEVTKPLVVRLDGNNAELG
RKILSDANHPLVQRVDTMDGAADKAAELAAAK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacgatgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcggctcgcgcagccaccgagcgtctgggtggc
aagtccgtggtcaaggcccaggtgaaggtcggtggccgcggcaaggccggcggcgtgaag
ctcgcggcgaccgccgacgaggcggtcgagcacgcgaccaacatcctcggcatggacatc
aagggccacacggtccacaaggtgatgatcgccgagacggctccggagatcgtcgaggag
tactacgtctcgtacctcctcgaccgcaccaaccgcaccttcctctccatcgcctccgtc
gagggcggcatggagatcgaggaggtggcggccacccgccccgaggccgtcgccaagacg
ccgatcgacgccaacgagggtgtgacccccgagaaggcccgcgagatcgtcgaggccgcg
aacttcccggccgaggtcgccgacaaggtcgtcaacgtcctggtgacgctgtggaagacc
ttcatcgaggaggacgccctcctcgtcgaggtcaacccgctggcgaaggtcgcctccggc
gacgtcatcgccctcgacggcaaggtctccctggacgagaacgcggacttccgccacccc
gaccacgaggagctcgtcgaccacgcggccgcgaaccccctcgaggccgcggccaaggag
aagaacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgcgggt
ctcgtcatgagcaccctggacgtcgtcgcgtacgccggtgagaaccacggtggcgtcaag
cccgccaacttcctcgacatcggcggtggcgcctccgccgccgtcatggcgaacggcctg
gagatcatcctgggcgacccggacgtcaagtccgtgttcgtcaacgtcttcggtggcatc
accgcctgtgacgaggtcgccaacggcatcgtccaggccctgcagctgctcaaggacaag
ggcgaggaagtcaccaagcccctcgtcgtccgtctggacggcaacaacgccgagctgggt
cgcaagatcctctccgacgccaaccacccgctggtccagcgcgtggacaccatggacggc
gcggccgacaaggccgccgagctcgcggccgcgaagtaa

DBGET integrated database retrieval system