KEGG   Streptomyces scabiei: SCAB_36081Help
Entry
SCAB_36081        CDS       T01187                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
scb  Streptomyces scabiei
Pathway
scb00984  Steroid degradation
scb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SCAB_36081
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SCAB_36081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 GIDA Pyr_redox HI0933_like Fer4_10 Lycopene_cycl Fer4
Motif
Other DBs
NCBI-ProteinID: CBG70697
UniProt: C9YUW3
Position
complement(4074655..4076436)
Genome map
AA seq 593 aa AA seqDB search
MSYDYDVIVVGSGFGGSVTALRLTEKGYKVGVLEAGRRFTRDSLPRNSWDLKNYLWAPAL
GLYGLQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKPFFEDPQWKDITDWQEELKPYY
DQARRMLGVRLNPTMTPSDVHLKATAERMGVGDSFHLAPVGVFFGDGEDADGKAKAAPGE
RVADPYFGGAGPARRACTECGECMTGCRHGAKNTLNENYLHLAEKAGAIVHPMTTVVAVT
EDSQGGYAVSTLPTDRLRKGAGRVLKARRVVLAAGTYGTQTLLHRMKANGLLPHISDRLG
MLTRTNSEALVGAQTDSRRYRKAHGAPEVDFTRGVAITSSIHPDENTHIEPVRYGKGSNA
MGGLSILQVPYAGGTASDASRVLGWLANAVRHPLLVARSLSNRRWSERTIIGLVMQSLDN
SLSTHLKPKGLGKGLLTARQGHGAPNPKQIEAASRAASTLAAEINGFAGSNVGELMGTPL
TAHFLGGCPIGATAADGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTITAQAERAMA
HWPNKGEPDHRPAPGAAYERLGPVQPLHPAVPADAFGALRLPLLPVPTVPPKK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtacgactacgacgtcatcgtcgtcggatccggtttcggcggctcggtcaccgcc
ctgcgtctgaccgagaagggctacaaggtgggcgtgctcgaagcgggccgccgtttcacg
cgcgactcgctcccgaggaactcctgggacctgaagaactacctctgggccccggccctc
ggcctgtacggcctgcagcgcatccacctgctgggcaacgtcatggtgctggccggggcc
ggcgtgggcggaggttccctcaactacgccaacaccctctacgtaccgccgaaaccgttc
ttcgaggacccgcagtggaaggacatcaccgactggcaggaggagctgaagccgtactac
gaccaggcccgccgcatgctcggcgtacggctcaatccgacgatgaccccctccgacgtg
cacctcaaggccaccgccgagcggatgggcgtcggtgacagcttccacctggccccggtc
ggtgtcttcttcggcgacggcgaggacgccgacggcaaggcgaaggccgctcccggtgag
cgggtggcggacccgtacttcggaggcgcgggccccgcccgcagggcctgcaccgagtgc
ggcgagtgcatgaccggctgccgccacggcgccaagaacaccctcaacgagaactacctc
cacctcgccgagaaggcgggcgcgatcgtccacccgatgacgacggtggtggccgtgacg
gaggactcgcagggcggctacgccgtgtcgaccctgccgaccgaccggctgcgcaaggga
gcgggccgcgtcctgaaggcccgccgcgtcgtcctggcggccggcacctacggcacccag
accctgctgcaccggatgaaggcgaacggcctgctgccgcacatctcggaccggctgggc
atgctgacccgcaccaactcggaggccctggtcggtgcccagaccgacagccgccgctac
cggaaggcccacggcgcgcccgaggtcgacttcacccggggcgtggccatcacctcctcc
atccaccccgacgagaacacccacatcgagccggtccgctacggcaagggctccaacgcg
atgggcggtctgtccatcctccaggtcccctacgcgggcggcaccgcgtcggacgcctcc
cgtgtcctcgggtggctggcgaacgcggtcaggcacccgctgctggtggcccgttcgctc
tccaaccgccgctggtcggagcggaccatcatcggtctggtgatgcagtcgctggacaac
tccctgtcgacgcacctcaagccgaaggggctcggcaagggcctgctgacggcgcgccag
ggtcatggcgcgcccaaccccaagcagatcgaggccgcttccagggccgcctccaccctg
gccgccgagatcaacggcttcgccggcagcaacgtgggcgagctgatgggcaccccgctc
accgcgcacttcctcggcggctgccccatcggtgccaccgcggccgacggcgtcatcgac
ccctaccaccgcctctacggccaccccggcatctccgtcgtcgacggcgccgccgtctcc
gcgaacctgggcgtgaacccctcgctgaccatcacggcacaggccgagcgcgcgatggcg
cactggccgaacaagggtgagcccgaccaccgtccggccccgggcgcggcctacgaacgg
ctcggccccgtgcagccgctgcatccggcggtcccggcggacgccttcggggcgctgcga
ctgcccctgttgccggtgccgacggtgccgccgaagaagtag

DBGET integrated database retrieval system