KEGG   Streptomyces scabiei: SCAB_3891Help
Entry
SCAB_3891         CDS       T01187                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scb  Streptomyces scabiei
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:scb00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448735..450381
Genome map
AA seq 548 aa AA seqDB search
MVPLHKRLLRLLTATALTFAACVTASAGTSAEAAPGSPALTPPLGWNSWNSFGCGITEAQ
VRQATDAMVSSGMREAGYRYVVVDDCWFDPQRDAAGNLRANPTKFPSGMKALGDYIHGKG
LKFGIYQAPNEKTCAQGVGTYPGSTGSKGHEAQDAAIFASWGVDYLKYDWCSGSGTLDQQ
IAQFTVMRDALRATGRPIVYSINPNSFHAPTGHTYDWGQVADLWRTTEDLLDIWQNGNTN
SYPMGVGNVLDITAPLAAQSGPGHWNDPDMLVVGRPGLSLTESRSHFALWSLLSAPLMAG
NDIRTMSADVSAVLRNPRLLAVNQDSLGAGGRRVRDDGDTEVFAKPLSDGSVAVGLLNRG
GSATTVTATAAQVGLTGGPFTLTDLWTGGTSSTSGQISASVPAHGVAVFKMTGGSPVTST
TARLRGTGSGRCLAVDRSSTAAGSAAVIWDCRTSADQQWTTWAGGEIRVYGDKCLDAYNQ
GTANNTRVIVWQCNGQNNQKWTPQADGSIRNVHAGLCLDAQQGATANGTPAVLWTCNGQN
NQRWTTLR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttcccctgcacaaacgactgctgcgtctcctcacggccaccgcactgacattcgcc
gcctgcgtcaccgcctccgccggcacgagcgccgaggccgcgccgggcagccccgccctc
accccgccgctgggctggaacagctggaacagcttcgggtgcgggatcaccgaggcccag
gtccgccaggccaccgacgcgatggtgtcctcggggatgcgggaagccggctaccggtac
gtggtggtcgacgactgctggttcgatccgcagcgcgacgcggccggcaacctccgggcc
aacccgaccaagttccccagcggcatgaaggcgctcggggactacatccacggcaagggc
ctgaagttcggcatctaccaggcgcccaacgagaagacgtgcgcccagggcgtgggcacc
taccccggctccaccggcagcaagggccacgaggcccaggacgccgcgatcttcgcctcc
tggggcgtcgactacctcaagtacgactggtgctccggcagcggcaccctcgatcagcag
atcgcgcagttcaccgtcatgcgcgacgccctgcgcgccaccgggcggccgatcgtctac
agcatcaatcccaacagcttccacgccccgaccggccacacctacgactggggccaggtc
gccgacctgtggcggacgaccgaggacctgctcgacatctggcagaacgggaacaccaac
agttatccgatgggcgtgggcaacgtcctggacatcaccgcgccgttggccgcccagtcg
ggtccgggccactggaacgaccccgacatgctggtcgtcggccgtcccgggctgtccctg
accgagtcccgctcccacttcgccctgtggtcgctgctctcggccccgctgatggccggc
aacgacatccgtaccatgtccgccgacgtgagcgcggtcctgcgcaacccccgtctgctc
gcggtgaaccaggactccctcggcgcgggcggacgcagggtgcgcgacgacggtgacacc
gaggtcttcgccaagcccctgtccgacggttcggtcgccgtgggactgctcaaccgggga
gggagcgcaaccaccgtcaccgccaccgccgcgcaggtcggcctcaccggaggaccgttc
accctcaccgacctgtggaccggcggcacgtcgagcacctccggccagatctccgcgagc
gtaccggcgcacggtgtcgccgtgttcaagatgaccggcggcagcccggtgacctccacc
accgcccgcctgcggggtaccggatcgggccgctgcctggccgtggaccggtcctccacc
gcggccgggtcggcggcggtgatctgggactgccggaccagcgccgaccagcagtggacg
acctgggcgggcggcgagatccgcgtctacggcgacaagtgcctggacgcgtacaaccag
gggaccgccaacaacacccgggtcatcgtctggcagtgcaacggccagaacaaccagaag
tggaccccccaggccgacgggtcgatccgcaacgtccacgccggtctgtgcctggacgcc
cagcagggggcgaccgccaacgggaccccggccgtcctgtggacctgcaacggacagaac
aaccagaggtggaccacgctccggtga

DBGET integrated database retrieval system