KEGG   Streptomyces scabiei: SCAB_39721Help
Entry
SCAB_39721        CDS       T01187                                 

Gene name
folP2
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scb  Streptomyces scabiei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCAB_39721 (folP2)
Enzymes [BR:scb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCAB_39721 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4462631..4463491
Genome map
AA seq 286 aa AA seqDB search
MQNGRGRVAGMPVWDRCAVMGVVNVTPDSFSDGGRWFDTTVAVKHGLDLVAEGADLVDVG
GESTRPGAARVDEAEELRRVVPVVRGLASEGVTVSVDTMRASVAEQALAAGAALVNDVSG
GLADPAMIPVVAEAGAPFVVMHWRGFLEGGNVRGVYEDVVAEVTRELHARVEAVLEGGVR
ADRVVVDPGLGFSKDAEHDLSLLAHLDRLLGLGHPLLVAASRKRFLGRVLAGPEGAPPPA
RERDAATAAVSALAARQGAWAVRVHEVRATADAVRVARAVEGARER
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgggcgcggccgggtggccggaatgcccgtgtgggaccgttgcgcggtcatg
ggggtcgtcaacgtcacccccgactcgttctccgacggcggccgctggttcgacaccacg
gtggccgtcaagcacggcctggacctggtcgcggagggcgcggacctggtggacgtgggc
ggagagtcgacccgccccggcgcggcccgggtcgacgaggcggaggagctccgcagggtc
gtcccggtcgtcaggggcctggcctccgagggcgtgaccgtctccgtggacaccatgcgc
gcctccgtggccgaacaggcgctcgccgccggcgccgccctcgtcaacgacgtcagcggc
ggcctcgccgaccccgcgatgatcccggtggtcgccgaggcgggcgcccccttcgtggtg
atgcactggcgcggcttcctggagggcggcaacgtccgcggcgtctacgaggacgtcgtc
gccgaggtgacgcgggagctgcacgcgcgcgtggaggccgtcctggagggcggtgtccgc
gcggaccgtgtcgtcgtcgacccgggactcgggttctccaaggacgccgagcacgacctc
tccctcctcgcccacctcgaccggctgctcggcctcggccaccccctgctggtggccgcg
tcccgcaaacgattcctcggccgggtgctggcgggcccggagggcgccccgccgccggcg
cgcgagcgggacgccgcgaccgccgccgtgtcggccctggccgcccggcagggcgcctgg
gcggtccgggtgcacgaggtgcgcgccaccgccgacgcggtccgcgtggcccgcgccgtc
gaaggggcccgggagcggtga

DBGET integrated database retrieval system