KEGG   Streptomyces scabiei: SCAB_39751Help
Entry
SCAB_39751        CDS       T01187                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
scb  Streptomyces scabiei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4464498..4465109
Genome map
AA seq 203 aa AA seqDB search
MTASFTAGQSDPTVQPVPASVVRKVDEADSTLHNPRRAVLSLGSNLGNRLETLQGAIDAL
EDTPGVRVKAVSPVYETEPWGVAPGSQPSYFNAVVVLKTTLPPSSLLERAQAVEEAFHRV
RDERWGPRTLDVDIVAYADVVSDDPLLTLPHPRAHERAFVLVPWHDVDPDALLTGRGPVA
ALLDGVAREGVTPRADLELHLPA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgtccttcaccgcgggtcagagcgacccgaccgtacagccggtgcccgcctcc
gtcgtgcggaaggtggacgaggccgactcgaccctgcacaacccccgccgggcggtcctc
tccctcggctcgaacctgggcaaccggctggagaccctccagggcgccatcgacgcgctg
gaggacacgccgggcgtccgcgtcaaggccgtgtcgccggtgtacgagaccgagccgtgg
ggggtggcgccgggcagccagccctcgtacttcaacgcggtcgtcgtcctgaagaccacc
ctgccgccctcctcgctgctggagcgggcccaggccgtggaggaggcgttccaccgggtg
cgggacgagcgctgggggccgcgcacgctggacgtcgacatcgtggcgtacgcggacgtc
gtctccgacgacccgctgctcaccctgccgcatccgcgcgcgcacgagcgggccttcgtc
ctcgtcccctggcacgacgtcgaccccgacgccctgctgacgggccgcggcccggtcgcc
gcgctcctcgacggtgtcgcccgcgagggcgtgacgccccgcgccgacctggaactccac
ctgcccgcgtag

DBGET integrated database retrieval system