KEGG   Streptomyces scabiei: SCAB_39771Help
Entry
SCAB_39771        CDS       T01187                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
scb  Streptomyces scabiei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4465689..4466294)
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGGGAIGEFDEKRAENAVRELLIAVGEDPDREGLKETPARVARAYQEIFAGLW
QQPEDVLTTTFDLGHDEMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSTSGKITGLSKLA
RLVDVYARRPQVQERMTTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTITSA
VRGQLRDAATRNEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccgtgacgctggacggtggcggcgccatcggcgagttcgacgagaagcgc
gccgagaacgccgtacgggagctgctgatcgcggtcggcgaggatcccgaccgggagggg
ctcaaggagacgccggcgcgggtggcgcgggcgtaccaggagatcttcgcggggctgtgg
cagcagccggaggacgtgctgaccacgaccttcgacctcgggcacgacgagatggtgctc
gtgaaggacatcgaggtgtacagcacctgcgagcatcacctggtgcccttccgcggtgtc
gcgcacgtcgggtacatcccgtcgaccagcggaaagatcaccggtctgtcgaagctggcc
cggctcgtggacgtctacgcccggcggccgcaggtgcaggagcggatgacgacgcagatc
gccgactcgctgatggagatcctggagccgcgcggggtgatcgtggtcgtggagtgcgag
cacatgtgcatgtcgatgcggggcatccgcaagcccggcgcgaagaccatcacgtcggcc
gtgcgcggccagctgcgggacgcggccacccgtaacgaggcgatgagcctgatcatggcc
cgctga

DBGET integrated database retrieval system