KEGG   Streptomyces scabiei: SCAB_41241Help
Entry
SCAB_41241        CDS       T01187                                 

Definition
acetyl-coprotein A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
scb  Streptomyces scabiei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:scb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scb00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:scb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:scb00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:scb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4649643..4651601
Genome map
AA seq 652 aa AA seqDB search
MSNESLANLLKEERRFAPPADLAENANVTAEAYEQARADRLGFWAAQARRLTWAKEPTET
LNWSNPPFAKWFEDGELNVAYNCVDRHVEAGNGDRVAIHFEGEPGDSRALTYAQLKDEVS
KAANALLELGVRAGDRVAVYLPMIPEAAVAMLACARIGAAHSVVFGGFSADALATRIQDA
DARVVITSDGGYRRGKPSALKPAVDDAADRAGNVEHVLVVRRTGQDVAWNDARDVWWHEI
VDRQSSEHTPQAFGAEHPLFILYTSGTTGKPKGILHTSGGYLTQTSYTHHAVFDLKPETD
VYWCTADVGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPT
AIRTFMKWGDDIPAKFDLSSLRVLGSVGEPINPEAWIWYRKHIGADTTPIVDTWWQTETG
AMMISPLPGVTATKPGSAQTPLPGISATVVDDEAREVPDGGGGYLVLTEPWPSMLRTIWG
DDQRFLDTYWSRFEGKYFAGDGAKKDDDGDIWLLGRVDDVMLVSGHNISTTEVESALVSH
PSVAEAAVVGAADETTGQAIVAFVILRGTANAEDEGLVADLRNHVGVTLGPIAKPKRILP
VQELPKTRSGKIMRRLLRDVAENRQLGDVTTLTDSTVMDLIQAKLPAAPSED
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaaagcctggccaacctcttgaaggaggagcgccgcttcgcgccgcctgcc
gacctggccgagaacgccaacgtcacggcggaggcgtacgagcaggccagggcggacagg
ctcggcttctgggcggcgcaggcccggcggctgacctgggccaaggagccgaccgagacg
ctgaactggtcgaatccgccgttcgccaagtggttcgaggacggcgaactcaacgtcgcc
tacaactgcgtcgaccggcatgtcgaggccggcaacggcgaccgggtcgccatccacttc
gagggggagcccggggacagcagggccctcacctacgcccagttgaaggacgaggtcagc
aaggcggcgaacgccctgctggaactgggtgtccgggccggcgaccgggtcgcggtgtac
ctgccgatgatcccggaggcggccgtggcgatgctcgcgtgcgcccggatcggcgccgcc
cactccgtcgtgttcggcggcttctccgccgacgcgctcgcgacccgtatccaggacgcg
gacgcgcgcgtggtcatcacctcggacggcggttaccggcgcggcaagccctccgcgctc
aagcccgccgtcgacgacgcggccgaccgcgccggcaatgtcgagcacgtcctcgtcgtc
cgccgcaccggacaggacgtcgcctggaacgacgcgcgtgacgtgtggtggcacgagatc
gtcgaccggcagagcagcgagcacaccccgcaggcgttcggggccgagcacccgctgttc
atcctgtacacgtccggcacgacgggtaagcccaagggcatcctgcacacctccggcggc
tacctcacccagacgtcgtacacccaccacgccgtcttcgacctcaagccggagacggac
gtgtactggtgcacggccgacgtcggctgggtcaccggccactcgtacatcgtctacggg
ccgctggccaacggcgcgacgcaggtcatgtacgagggcacgccggacaccccgcaccag
ggccggttctgggagatcgtgcagaagtacggggtgacgatcctctacacggcgcccacg
gcgatccgcacgttcatgaagtggggcgacgacatccccgcgaagttcgacctcagcagt
ctgcgggtgctcggctcggtcggtgagcccatcaaccccgaggcgtggatctggtaccgc
aagcacatcggcgccgacacgacgccgatcgtggacacctggtggcagaccgagaccggc
gcgatgatgatctccccgctgccaggcgtgacggcgaccaagccgggctcggcgcagacg
ccgctgccgggcatctccgccacggtggtggacgacgaggcgcgggaggtcccggacggc
ggtggcggttacctggtcctgaccgagccgtggccctcgatgctgcgcaccatctggggt
gacgaccagcggttcctcgacacgtactggtcgcggttcgagggcaagtacttcgccggc
gacggggcgaagaaggacgacgacggggacatctggctcctcgggcgcgtcgacgacgtg
atgctcgtgtcgggccacaacatctcgacgaccgaggtggagtccgctctcgtgtcgcac
ccctccgtggccgaggcggccgtcgtcggggcggccgacgagaccaccggtcaggcgatc
gtggcgttcgtgatcctgcgcggcacggcgaacgccgaggacgagggcctcgtcgccgat
ctgcgcaaccacgtcggcgtcaccctcggtccgatcgccaagcccaagcgcatcctgccg
gtgcaggagctgccgaagacgcgctccgggaagatcatgcggcgtctgctgcgtgacgtg
gcggagaacaggcagctcggcgacgtcaccacgctgaccgactccacggtgatggacctg
atccaggccaagctgccggcggcaccgagcgaggactga

DBGET integrated database retrieval system