KEGG   Streptomyces scabiei: SCAB_41241Help
Entry
SCAB_41241        CDS       T01187                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
scb  Streptomyces scabiei
Pathway
scb00010  Glycolysis / Gluconeogenesis
scb00620  Pyruvate metabolism
scb00640  Propanoate metabolism
scb00680  Methane metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_41241
   00620 Pyruvate metabolism
    SCAB_41241
   00640 Propanoate metabolism
    SCAB_41241
  Energy metabolism
   00680 Methane metabolism
    SCAB_41241
Enzymes [BR:scb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SCAB_41241
Lipid biosynthesis proteins [BR:scb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SCAB_41241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MlrC_C
Motif
Other DBs
NCBI-ProteinID: CBG71197
UniProt: C9Z2I3
Position
4649643..4651601
Genome map
AA seq 652 aa AA seqDB search
MSNESLANLLKEERRFAPPADLAENANVTAEAYEQARADRLGFWAAQARRLTWAKEPTET
LNWSNPPFAKWFEDGELNVAYNCVDRHVEAGNGDRVAIHFEGEPGDSRALTYAQLKDEVS
KAANALLELGVRAGDRVAVYLPMIPEAAVAMLACARIGAAHSVVFGGFSADALATRIQDA
DARVVITSDGGYRRGKPSALKPAVDDAADRAGNVEHVLVVRRTGQDVAWNDARDVWWHEI
VDRQSSEHTPQAFGAEHPLFILYTSGTTGKPKGILHTSGGYLTQTSYTHHAVFDLKPETD
VYWCTADVGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPT
AIRTFMKWGDDIPAKFDLSSLRVLGSVGEPINPEAWIWYRKHIGADTTPIVDTWWQTETG
AMMISPLPGVTATKPGSAQTPLPGISATVVDDEAREVPDGGGGYLVLTEPWPSMLRTIWG
DDQRFLDTYWSRFEGKYFAGDGAKKDDDGDIWLLGRVDDVMLVSGHNISTTEVESALVSH
PSVAEAAVVGAADETTGQAIVAFVILRGTANAEDEGLVADLRNHVGVTLGPIAKPKRILP
VQELPKTRSGKIMRRLLRDVAENRQLGDVTTLTDSTVMDLIQAKLPAAPSED
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaaagcctggccaacctcttgaaggaggagcgccgcttcgcgccgcctgcc
gacctggccgagaacgccaacgtcacggcggaggcgtacgagcaggccagggcggacagg
ctcggcttctgggcggcgcaggcccggcggctgacctgggccaaggagccgaccgagacg
ctgaactggtcgaatccgccgttcgccaagtggttcgaggacggcgaactcaacgtcgcc
tacaactgcgtcgaccggcatgtcgaggccggcaacggcgaccgggtcgccatccacttc
gagggggagcccggggacagcagggccctcacctacgcccagttgaaggacgaggtcagc
aaggcggcgaacgccctgctggaactgggtgtccgggccggcgaccgggtcgcggtgtac
ctgccgatgatcccggaggcggccgtggcgatgctcgcgtgcgcccggatcggcgccgcc
cactccgtcgtgttcggcggcttctccgccgacgcgctcgcgacccgtatccaggacgcg
gacgcgcgcgtggtcatcacctcggacggcggttaccggcgcggcaagccctccgcgctc
aagcccgccgtcgacgacgcggccgaccgcgccggcaatgtcgagcacgtcctcgtcgtc
cgccgcaccggacaggacgtcgcctggaacgacgcgcgtgacgtgtggtggcacgagatc
gtcgaccggcagagcagcgagcacaccccgcaggcgttcggggccgagcacccgctgttc
atcctgtacacgtccggcacgacgggtaagcccaagggcatcctgcacacctccggcggc
tacctcacccagacgtcgtacacccaccacgccgtcttcgacctcaagccggagacggac
gtgtactggtgcacggccgacgtcggctgggtcaccggccactcgtacatcgtctacggg
ccgctggccaacggcgcgacgcaggtcatgtacgagggcacgccggacaccccgcaccag
ggccggttctgggagatcgtgcagaagtacggggtgacgatcctctacacggcgcccacg
gcgatccgcacgttcatgaagtggggcgacgacatccccgcgaagttcgacctcagcagt
ctgcgggtgctcggctcggtcggtgagcccatcaaccccgaggcgtggatctggtaccgc
aagcacatcggcgccgacacgacgccgatcgtggacacctggtggcagaccgagaccggc
gcgatgatgatctccccgctgccaggcgtgacggcgaccaagccgggctcggcgcagacg
ccgctgccgggcatctccgccacggtggtggacgacgaggcgcgggaggtcccggacggc
ggtggcggttacctggtcctgaccgagccgtggccctcgatgctgcgcaccatctggggt
gacgaccagcggttcctcgacacgtactggtcgcggttcgagggcaagtacttcgccggc
gacggggcgaagaaggacgacgacggggacatctggctcctcgggcgcgtcgacgacgtg
atgctcgtgtcgggccacaacatctcgacgaccgaggtggagtccgctctcgtgtcgcac
ccctccgtggccgaggcggccgtcgtcggggcggccgacgagaccaccggtcaggcgatc
gtggcgttcgtgatcctgcgcggcacggcgaacgccgaggacgagggcctcgtcgccgat
ctgcgcaaccacgtcggcgtcaccctcggtccgatcgccaagcccaagcgcatcctgccg
gtgcaggagctgccgaagacgcgctccgggaagatcatgcggcgtctgctgcgtgacgtg
gcggagaacaggcagctcggcgacgtcaccacgctgaccgactccacggtgatggacctg
atccaggccaagctgccggcggcaccgagcgaggactga

DBGET integrated database retrieval system