KEGG   Streptomyces scabiei: SCAB_4201Help
Entry
SCAB_4201         CDS       T01187                                 

Definition
hypothetical protein
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
scb  Streptomyces scabiei
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:scb00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(480316..482694)
Genome map
AA seq 792 aa AA seqDB search
MTQVEHQNVTVLSDDELRTLDAHWRAANYLAAGQIYLRANPLLTEPLLPEHIKPRLLGHW
GTSPGLNLVYTHLNRVISARDLDALCVWGPGHGGPSVLAGSWLDGSYSETYPDVTRDAPG
MARLFRQFSFPGGVPSHVAPEVPGSIHEGGELGYSLAHAYGAAFDNPGLLVTCVIGDGEA
ETGPLAASWHSNKFLDPVHDGAVLPILHLNGYKIANPTVLSRLPQAELDALLRGYGHTPL
HVTGDDPATVHRALAHAFDEALDRIARLQRTAREDGVAERAHWPMIVLRTPKGWTGPAEV
DGLPVEGTWRAHQVPLAGVRENPEHLRQLETWLRSYRPQELFGPDGRPVADVLAHIPSGT
RRLGATPHANGGLLLRDLPIRPLDDFAVPVDKPGTTLHEPTRVLGDLLARIMRDTRSRRD
FRVVGPDETASNRLQAVFDASGKAWQAEHLPVDEHLDRHGRVLEILSEHLCQGWLEGYLL
TGRHGLFSCYEAFVHIVDSMVNQHIKWLRTSRELSWRAPVASLTYLLTSHVWRQDHNGFS
HQDPGFVDHVLNKSPEVVRVYLPPDANTLLSVADHALRSRDLVNVIVAGKQPCFDWLSMD
QARAHCARGAGIWEWAGSENGGEPDVVLACAGDVPTQEILAAAQLLRRHLPQLAVRVVNV
VDMTRLLPREEHPHGMSDFEYDGLFTTDKPVIFAYHGYPWLVHRLAYRRTGHRNLHVRGY
KESGTTTTPFDMVVRNDLDRYRLVMDVIDRVPGLAVRAAAVRQQMADTRTRHHAWIREHG
TDLPEVADWHWA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggtcgaacaccagaacgtcaccgtactttccgacgacgagctgcgcaccctg
gacgcccactggcgggccgccaactacctcgcggccggacagatctacctccgggcgaac
ccgctgctgaccgaaccgctgctccctgaacacatcaagccgcggctgctcggtcactgg
ggcacctcgccgggcctgaacctggtctacacccacctcaaccgggtgatctcagcacgc
gacctggacgccctgtgcgtctgggggcccggtcacggcgggccgtccgtcctggccggc
tcctggctggacggcagctacagcgagacctacccggacgtcacacgcgacgcgcccggc
atggcacggctcttccggcagttctccttccccggcggggtaccgagccatgtggccccc
gaggtgccgggctcgatccacgagggcggtgaactcggctactccctcgcccatgcctac
ggcgccgccttcgacaaccccggcctgctggtgacctgcgtcatcggcgacggcgaggcg
gagaccgggcccctggccgcctcctggcactccaacaagttcctcgacccggtccacgac
ggtgccgtcctgccgatcctccacctcaacggctacaagatcgccaacccgacggtcctg
tcccgcctgccccaggccgaactcgacgccctgctgcgcggctacggccacacccccctc
cacgtcaccggcgacgacccggccaccgtccaccgcgccctggcccacgccttcgacgag
gcactggaccgcatcgcccgcctgcagcgcaccgcacgcgaggacggcgtcgccgaacgc
gcccactggccgatgatcgtgctgcgcacccccaagggctggaccggccccgccgaggtc
gacggcctgcccgtcgaagggacctggcgcgcccaccaggtcccgctcgccggggtacgc
gagaacccggaacacctccggcagttggagacctggctgcgctcgtaccggccccaggag
ctgttcggcccggacggccggcccgtcgccgacgtcctcgcccacatcccctccggcacc
aggcgactgggcgccaccccgcacgccaacggcggcctcctcctccgcgacctccccatc
cgccccctggacgacttcgccgtaccggtggacaagccgggcacgacgctccacgaaccg
acccgggtcctcggtgacctcctggcccggatcatgcgggacacccgctcgcgccgggac
ttccgggtcgtcggaccggacgagaccgcctccaaccggctgcaggccgtcttcgacgcc
agcggcaaggcctggcaggccgaacacctcccggtcgacgaacacctcgaccggcacggc
cgggtactggagatcctctccgaacacctctgccagggctggctggagggctacctgctc
accggccgacacggtctgttctcctgctacgaggcgttcgtgcacatcgtcgactccatg
gtcaaccagcacatcaagtggctgcggacctcccgggagctgtcctggcgggcgcccgtc
gcctccctcacctacctgctcacgtcccacgtctggcgccaggaccacaacggcttctcc
caccaggaccccggcttcgtcgaccacgtcctcaacaagagccccgaggtcgtccgcgtc
tacctgcccccggacgccaacaccctcctgtccgtcgccgaccacgccctgcgcagccgc
gacctcgtcaacgtgatcgtggccggcaaacagccctgcttcgactggctgtccatggac
caggcccgcgcccactgcgcgcgcggagccgggatctgggagtgggcgggcagcgagaac
ggcggcgaaccggacgtcgtcctcgcctgtgccggcgacgtgcccacccaggagatcctg
gccgcggcgcagctgctgcgccgccatctgccgcagctcgccgtccgggtggtcaacgtc
gtcgacatgacccggctgctgccgcgcgaggaacacccgcacgggatgagcgacttcgag
tacgacggcctgttcaccaccgacaagccggtgatcttcgcctaccacggctatccgtgg
ctcgtgcaccgcctcgcctaccgccgcacgggccaccggaacctgcacgtacgcggctac
aaggagtcgggcacgacgaccacgcccttcgacatggtcgtccgcaacgacctcgaccgc
taccggctggtcatggacgtcatcgaccgcgtgcccggcctcgccgtccgggccgccgcc
gtacgccagcagatggccgacacccgtacccgccaccatgcctggatccgcgagcacggc
accgatctgccggaggtcgccgactggcactgggcctga

DBGET integrated database retrieval system