KEGG   Streptomyces scabiei: SCAB_44201Help
Entry
SCAB_44201        CDS       T01187                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
scb  Streptomyces scabiei
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCAB_44201
  Lipid metabolism
   00600 Sphingolipid metabolism
    SCAB_44201
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCAB_44201
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCAB_44201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4962851..4966786
Genome map
AA seq 1311 aa AA seqDB search
MPHPHPHTGTPAARPVMSRRRLLEGGAALLGAVALSGGAAHAAPLLASKADGTPEWSGNM
ALFQVGAEPPHTTLMPYADVRQALAADRTRSPYRLSLDGKWRFAYVERPGDRDEDFYKTD
VDDSDWDTIPVPSNWQLHGYDFPIYINITYPWWGPNGLGEEAQPPNAPTRYNPVGQYRRS
FNLPKDWTAGDRRTFLHFEGVKSAHYVWINGELVGYHEDSYDPAEYDITPHLKPGSNQIA
VEVYRYSDGDWLEDQDMIRLSGIFRSVYLYSTPAVHLRDFKLDTPLGDGYTTAELSVTAS
VRAYAAGHEGAYSVETQLYDAGGHAVWSRPLVQSVTVGASATGEDVTVQAARSVPSPELW
SAEHPTLYTAVLQLRDPAGKVVETLSHRVGLREFALRNGLMRINGKPVSLRGTNRHEMHP
DRGMALTRADLVQDMGIIKRLNINSVRTSHYPNNPLWYELADEYGLYLVDETNLETHGIR
DRFPGNDPDWTKACVARARNMVHRDKNHASVVIWSLGNEAGGGSTFVAMRDWIESYDKTR
VIQYEGDDRPTISQIRSEMYDSPQRVEQRAKDTSDTRPYVMIEYSHSMGNSTGNFKKYWD
LVRRYPVLQGGWIWDFVDQSLTWPIPRLKVFTDAGPSKLQGQLLTAAGTFSRDKGLSGAT
GFTRDPALNLTGSLTLEAWFTPHVTGGHQPIIAKGDTHYALKQSEKSIEFFIYGGGQWVS
VSWGLPAEGWTGREHHVAGVFDAGSGSLTLYVDGEVKATRSTTRRPSANVAPLALGTDTD
NPTRELSGTIRRARVYARALSGSELASTGRGAGDEGVRFWFDAATVEVKESRAKDRSFLA
YGGDWGDNPNDGAFVADGIIKADRGHTGKAAEVKRIYQAVHAKPATGTTLASKKVTLTNE
FLFTNLRELDGGWTLVADGRKIQEGRLTRDQLDVGPLSAKDITVPFDLPASPAPGTEYFL
ELSFTTKDSAPWAEAGFEVAREQLSVDAGSPAVTPVPLADVPELTYEESDEAVTVTGKGY
PGRFSVTVDKASGTITSYKAGGNRLISDGPVPNFWRAPTDNDHGNGQHTRNQTWRDAGTN
RKVTSVTVRSLGDDRAVEIKVTGTLPTTTESTYTTTYTVFGNAEIKVDNTLHPGASSLPY
IPEVGTLFLLNRRLERLHYYGRGPEENHWDRNNGTDVGLYSGDIADQWSGYIRPQENGNK
TDVRWAAVTDRNGEGLLVSGDGLIEINASYFTPEDLSTGLRHDYHLTPRDTPVLRVNHRQ
MGVGGDNSWGAHTHDEYKLFANRDYTYTYRLRPLTDVAGATAASRRPTATR
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgccccacccgcacccgcacacaggcacccccgccgcccgccccgtcatgagccgccgc
cgcctgctggagggcggcgccgccctcctcggcgccgtggccctctccggtggcgccgcc
cacgcggccccgctcctcgcgtcgaaggccgacggcacccccgagtggtccggcaacatg
gccctcttccaggtcggcgccgaaccgccgcacaccaccctcatgccgtacgcggacgtc
agacaggctctggccgccgaccgcacccgttccccgtaccggctgagcctcgacggcaag
tggcggttcgcgtacgtcgaacggcccggcgaccgggacgaggacttctacaagacggac
gtcgacgacagcgactgggacaccatcccggtgccgtccaactggcagctgcacggctac
gacttccccatctacatcaacatcacctacccctggtggggccccaacggcctcggcgag
gaggcgcagccgccgaacgcgccgacgcgctacaaccccgtcggccagtaccggcgcagc
ttcaacctgcccaaggactggacggccggcgaccgccgtaccttcctgcacttcgagggc
gtcaagtcggcccactacgtgtggatcaacggcgaactcgtcggctaccacgaggactcc
tacgacccggccgagtacgacatcaccccgcacctgaagccggggtcgaaccagatcgcc
gtcgaggtctaccggtactcggacggcgactggctggaggaccaggacatgatccggctg
agcggcatcttccgctcggtctacctctactccaccccggccgtgcacctgcgcgacttc
aagctggacaccccgctcggcgacggctacaccaccgccgagctgtccgtcaccgcgagc
gtgcgcgcctacgcggccgggcacgagggcgcgtactccgtggagacgcagctctacgac
gccggcggacacgccgtctggtcccgccccctcgtccagtccgtcaccgtcggcgcctcc
gccaccggtgaggacgtgaccgtgcaggccgcccggtccgtgccgtcccccgagctgtgg
tccgccgagcacccgaccctctacacggccgtgctgcagctgcgcgacccggccggcaag
gtcgtcgagaccctctcccaccgcgtcggcctgcgcgagttcgcgctcaggaacgggctg
atgcggatcaacggcaaaccggtctccctgcggggcaccaaccgccacgagatgcacccc
gaccggggcatggcgctcacccgcgccgacctggtccaggacatgggcatcatcaagcgg
ctcaacatcaactccgtgcgcacctcgcactatcccaacaacccgctctggtacgagctg
gcggacgagtacggcctctacctcgtcgacgagacgaacctggagacgcacggcatccgg
gaccgcttccccggcaacgaccccgactggaccaaggcgtgcgtggcccgcgcccggaac
atggtccaccgcgacaagaaccacgcctccgtcgtcatctggtccctcggcaacgaggcg
ggcggcggctccaccttcgtcgccatgcgcgactggatcgagtcgtacgacaagacccgc
gtcatccagtacgagggcgacgaccggccgaccatcagccagatacggtcggagatgtac
gacagcccgcaacgcgtcgagcagcgggccaaggacacctccgacacccggccgtacgtg
atgatcgagtactcgcactcgatggggaactcgaccggcaacttcaagaagtactgggac
ctcgtccggcgctaccccgtcctccagggcggctggatctgggacttcgtcgaccagtcg
ctgacctggccgatcccgcggctgaaggtcttcaccgacgccggcccgagcaagctgcag
ggccaactgctcaccgccgcaggaacgttcagccgcgacaagggcctctccggcgccacc
ggcttcacccgcgaccccgccctcaacctcaccggctccctgacgctggaggcgtggttc
accccgcacgtcaccggcggccaccagccgatcatcgccaagggcgacacccactacgcg
ctgaagcagagcgagaagagcatcgagttcttcatctacggcggcggccagtgggtcagc
gtcagctggggcctcccggccgagggctggaccggccgcgagcaccatgtcgccggtgtc
ttcgacgccggttccgggtccctcaccctctacgtcgacggcgaggtgaaggcgacccgc
agcacgacccggcggcccagcgcgaacgtggccccgctcgcgctcggcaccgacacggac
aacccgacgcgcgaactcagcggcacgatccggcgggcgcgcgtgtacgcccgcgccctg
agcggctccgaactggcctccacggggcgtggcgccggtgacgagggggtgcgtttctgg
ttcgacgcggccacggtcgaggtgaaggagagccgggcgaaggaccgttcgttcctcgcg
tacggcggtgactggggcgacaaccccaacgacggcgccttcgtcgcggacggcatcatc
aaggccgaccggggccacaccggcaaggccgccgaggtcaagcgcatctaccaggccgtg
cacgcgaagccggccaccggcaccaccctggcctcgaagaaggtcacgctcaccaacgag
ttcctcttcaccaacctccgggaactcgacggcggttggacgctggtggccgacggcagg
aagatccaggagggccgcctcacccgcgaccagctggacgtcggcccgctgtccgccaag
gacatcaccgtccccttcgacctccccgcctccccggcccccggcaccgagtacttcctc
gaactctccttcaccaccaaggactccgccccgtgggccgaggccggcttcgaggtggcc
cgggagcagctgtccgtggacgcgggcagcccggcggtgacccccgtcccgctcgcggac
gtcccggagctgacgtacgaggagagcgacgaggccgtcacggtgaccggcaagggctac
ccgggccgcttctccgtcaccgtcgacaaggcgagcggcacgatcacctcgtacaaggcg
ggcggcaaccggctgatctccgacggaccggtgcccaacttctggcgggcccccaccgac
aacgaccacggcaacggacagcacacccggaaccagacctggcgggacgcgggcacgaac
cgcaaggtgacgtccgtgaccgtccgctccctgggcgacgaccgggccgtggagatcaag
gtcaccggcacgctcccgacgaccaccgagtccacctacacgaccacctacacggtgttc
ggcaacgccgagatcaaggtcgacaacaccctgcacccgggcgcctcctccctgccgtac
atcccggaggtgggaaccctgttcctgctcaaccgccgcctggagcgcctgcactactac
ggccgcggccccgaggagaaccactgggaccgcaacaacggcaccgacgtgggcctctac
tccggcgacatcgccgaccagtggtcgggctacatccgcccccaggagaacggcaacaag
accgacgtccgctgggccgccgtcacggaccgcaacggtgagggcctgctggtctcgggc
gacggcctgatcgagatcaacgcctcgtacttcaccccggaggacctgtcgacgggcctg
cgccacgactaccacctcaccccccgcgacaccccggtcctgcgcgtcaaccaccgtcag
atgggagtcggcggcgacaacagctggggcgcccacacccacgacgagtacaagctcttc
gccaaccgcgactacacgtacacgtaccggctgcgcccgctgacggacgtggcgggggcc
acggcggcgtcgaggaggccgacggcgacgaggtag

DBGET integrated database retrieval system