KEGG   Streptomyces scabiei: SCAB_45291Help
Entry
SCAB_45291        CDS       T01187                                 

Gene name
bkdC
Definition
(GenBank) E2 branched-chain alpha keto acid dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scb  Streptomyces scabiei
Pathway
scb00010  Glycolysis / Gluconeogenesis
scb00020  Citrate cycle (TCA cycle)
scb00620  Pyruvate metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb01130  Biosynthesis of antibiotics
scb01200  Carbon metabolism
Module
scb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAB_45291 (bkdC)
   00020 Citrate cycle (TCA cycle)
    SCAB_45291 (bkdC)
   00620 Pyruvate metabolism
    SCAB_45291 (bkdC)
Enzymes [BR:scb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCAB_45291 (bkdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CBG71592
UniProt: C9Z8W7
Position
complement(5080923..5082266)
Genome map
AA seq 447 aa AA seqDB search
MAQVLEFKLPDLGEGLTEAEIVRWLVQVGDVVAIDQPVVEVETAKAMVEVPCPYGGVVTA
RFGEEGTELPVGAPLLTVAVGAPAADATAGEGSGNVLVGYGTGAPPARRRRVRPGEPVRS
TPSAGPAARRTVVDTTPVPVAAPACPDGPVPVISPLVRRLARENGLDLRTLHGSGPEGLI
LRADVEHALRAATAPATAPASVPEPSAVAARPAPAEAPSATRIPLRGVRGAVADKLSRSR
REIPDATCWVDADATELMRARTAMNAAGGPKISVLALLARICTAALARFPELNSTVDMEA
REIVRLDRVHLGFAAQTERGLVVPVVRDAHTRNTESLTAEFAGLTEAARTGTLTPGQLTG
GTFTLNNYGVFGVDGSTPIINHPEAAMLGVGRIVPKPWVHEGELAVRQVVQLSLTFDHRV
CDGGTAGGFLRFVADCVEQPAMLLRTL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtgctggagttcaagctgcccgacctcggggaggggctgaccgaggccgag
atcgtgcgctggctggtccaggtcggggacgtcgtcgcgatcgaccagccggtcgtcgag
gtcgagacggccaaggccatggtcgaggttccctgcccctacggcggtgtcgtcaccgcc
cgcttcggcgaggagggcacggaactgcccgtcggtgctcccctgttgacggtggcggtg
ggggcacccgccgcggacgccaccgccggtgagggctccggcaacgtgctggtcggctac
ggcaccggtgcgccgccggcgcgccgcaggcgggtgcggcccggggaaccggtccggtcc
accccgtcggccgggccggcggcccggcgcaccgtcgtcgacacgacaccggtcccggtc
gccgctcccgcgtgcccggacggacccgtgccggtcatctccccgctcgtccgccgtctc
gcccgcgagaacggcctggacctgcggaccctgcacggttcgggccccgaggggctgatc
ctgcgggccgacgtggagcacgcgctgcgggccgccacggcccccgccaccgctcccgcc
tcggttccggagccgagtgccgtcgccgcgcggcccgcgcccgccgaggcgccctccgcc
acccgcatccccctgcggggcgtccggggcgccgtcgccgacaagctctcccggagccgg
cgcgagatccccgacgccacctgctgggtggacgccgacgcgacggaactgatgcgcgcc
cgtacggcgatgaacgcggccggtggtccgaagatctccgtcctcgcgctgctcgcccgg
atctgcacggccgcgctggcccgtttcccggagctgaactcgacggtcgacatggaggcc
cgggagatcgtccggctcgaccgggtgcacctcgggttcgccgcgcagaccgagcgaggg
ctggtcgtgcccgtcgtccgggacgcgcacaccaggaacacggaatcgctcaccgccgag
ttcgccggcctgaccgaggcggcccggaccgggaccctgacacccggccagctgaccggc
gggaccttcaccctgaacaactacggcgtgttcggtgtcgacggctccacgccgatcatc
aaccaccccgaggccgccatgcttggcgtcggccgtatcgtccccaagccgtgggtgcac
gagggcgagctggccgtacggcaggtcgtgcagctctcgctcaccttcgaccaccgggtg
tgcgacggcggcacggcgggcggcttcctgcgcttcgtggccgactgtgtcgaacagccg
gcgatgctgctgcgcacgctctga

DBGET integrated database retrieval system